Recombinant Human AMTN protein, His-tagged
| Cat.No. : | AMTN-390H |
| Product Overview : | Recombinant Human AMTN protein(17-209 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 17-209 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | LPQLKPALGLPPTKLAPDQGTLPNQQQSNQVFPSLSLIPLTQMLTLGPDLHLLNPAAGMTPGTQTHPLTLGGLNVQQQLHPHVLPIFVTQLGAQGTILSSEELPQIFTSLIIHSLFPGGILPTSQAGANPDVQDGSLPAGGAGVNPATQGTPAGRLPTPSGTDDDFAVTTPAGIQRSTHAIEEATTESANGIQ |
| Gene Name | AMTN amelotin [ Homo sapiens ] |
| Official Symbol | AMTN |
| Synonyms | UNQ689 |
| Gene ID | 401138 |
| mRNA Refseq | NM_212557.2 |
| Protein Refseq | NP_997722.1 |
| MIM | 610912 |
| UniProt ID | Q6UX39 |
| ◆ Recombinant Proteins | ||
| ABHD6-218M | Recombinant Mouse ABHD6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| AMTN-390H | Recombinant Human AMTN protein, His-tagged | +Inquiry |
| ABHD6-880HF | Recombinant Full Length Human ABHD6 Protein, GST-tagged | +Inquiry |
| ABHD6-475HFL | Recombinant Full Length Human ABHD6 Protein, C-Flag-tagged | +Inquiry |
| ABHD6-14H | Recombinant Human ABHD6 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ABHD6-9131HCL | Recombinant Human ABHD6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABHD6 Products
Required fields are marked with *
My Review for All ABHD6 Products
Required fields are marked with *
