Recombinant Human ABI3BP Protein, GST-Tagged

Cat.No. : ABI3BP-090H
Product Overview : Human ABI3BP partial ORF ( NP_056244.2, 511 a.a. - 609 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ABI3BP (ABI Family Member 3 Binding Protein) is a Protein Coding gene. GO annotations related to this gene include heparin binding and glycosaminoglycan binding. An important paralog of this gene is FNDC1.
Molecular Mass : 36.63 kDa
AA Sequence : KTQFISLKPKIPLSPEVTHTKPAPKQTPRAPPKPKTSPRPRIPQTQPVPKVPQRVTAKPKTSPSPEVSYTTPAPKDVLLPHKPYPEVSQSEPAPLETRG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ABI3BP ABI family, member 3 (NESH) binding protein [ Homo sapiens ]
Official Symbol ABI3BP
Synonyms ABI3BP; ABI family, member 3 (NESH) binding protein; target of Nesh-SH3; DKFZP586L2024; NESHBP; target of Nesh SH3; TARSH; nesh-binding protein; ABI gene family member 3-binding protein; ABI gene family, member 3 (NESH) binding protein; FLJ41743; FLJ41754;
Gene ID 25890
mRNA Refseq NM_015429
Protein Refseq NP_056244
MIM 606279
UniProt ID Q7Z7G0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABI3BP Products

Required fields are marked with *

My Review for All ABI3BP Products

Required fields are marked with *

0
cart-icon
0
compare icon