Recombinant Human ABI3BP Protein, GST-Tagged
Cat.No. : | ABI3BP-090H |
Product Overview : | Human ABI3BP partial ORF ( NP_056244.2, 511 a.a. - 609 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ABI3BP (ABI Family Member 3 Binding Protein) is a Protein Coding gene. GO annotations related to this gene include heparin binding and glycosaminoglycan binding. An important paralog of this gene is FNDC1. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | KTQFISLKPKIPLSPEVTHTKPAPKQTPRAPPKPKTSPRPRIPQTQPVPKVPQRVTAKPKTSPSPEVSYTTPAPKDVLLPHKPYPEVSQSEPAPLETRG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ABI3BP ABI family, member 3 (NESH) binding protein [ Homo sapiens ] |
Official Symbol | ABI3BP |
Synonyms | ABI3BP; ABI family, member 3 (NESH) binding protein; target of Nesh-SH3; DKFZP586L2024; NESHBP; target of Nesh SH3; TARSH; nesh-binding protein; ABI gene family member 3-binding protein; ABI gene family, member 3 (NESH) binding protein; FLJ41743; FLJ41754; |
Gene ID | 25890 |
mRNA Refseq | NM_015429 |
Protein Refseq | NP_056244 |
MIM | 606279 |
UniProt ID | Q7Z7G0 |
◆ Recombinant Proteins | ||
ABI3BP-2886H | Recombinant Human ABI3BP protein, His-tagged | +Inquiry |
ABI3BP-090H | Recombinant Human ABI3BP Protein, GST-Tagged | +Inquiry |
ABI3BP-3665H | Recombinant Human ABI3BP protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABI3BP-10HCL | Recombinant Human ABI3BP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABI3BP Products
Required fields are marked with *
My Review for All ABI3BP Products
Required fields are marked with *
0
Inquiry Basket