Recombinant Human ABI3BP Protein, GST-Tagged

• Cat.No.: ABI3BP-090H
• Product Overview: Human ABI3BP partial ORF ( NP_056244.2, 511 a.a. - 609 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ABI3BP (ABI Family Member 3 Binding Protein) is a Protein Coding gene. GO annotations related to this gene include heparin binding and glycosaminoglycan binding. An important paralog of this gene is FNDC1.
• Molecular Mass: 36.63 kDa
• AA Sequence: KTQFISLKPKIPLSPEVTHTKPAPKQTPRAPPKPKTSPRPRIPQTQPVPKVPQRVTAKPKTSPSPEVSYTTPAPKDVLLPHKPYPEVSQSEPAPLETRG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ABI3BP ABI family, member 3 (NESH) binding protein [ Homo sapiens ]
• Official Symbol: ABI3BP
• Synonyms: ABI3BP; ABI family, member 3 (NESH) binding protein; target of Nesh-SH3; DKFZP586L2024; NESHBP; target of Nesh SH3; TARSH; nesh-binding protein; ABI gene family member 3-binding protein; ABI gene family, member 3 (NESH) binding protein; FLJ41743; FLJ41754
• Gene ID: 25890
• mRNA Refseq: NM_015429
• Protein Refseq: NP_056244
• MIM: 606279
• UniProt ID: Q7Z7G0