Recombinant Human ABI3BP protein, GST-tagged
| Cat.No. : | ABI3BP-3665H |
| Product Overview : | Recombinant Human ABI3BP protein(221-419 aa), fused to GST tag, was expressed in E. coli. |
| Availability | February 01, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 221-419 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | GSKKVNGKIQSTYDQDHTVPAYVPRKLIPITIIKQVIQNVTHKDSAKSPEKAPLGGVILVHLIIPGLNETTVKLPASLMFEISDALKTQLAKNETLALPAESKTPEVEKISARPTTVTPETVPRSTKPTTSSALDVSETTLASSEKPWIVPTAKISEDSKVLQPQTATYDVFSSPTTSDEPEISDSYTATSDRILDSIP |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ABI3BP ABI family, member 3 (NESH) binding protein [ Homo sapiens ] |
| Official Symbol | ABI3BP |
| Synonyms | ABI3BP; ABI family, member 3 (NESH) binding protein; target of Nesh-SH3; DKFZP586L2024; NESHBP; target of Nesh SH3; TARSH; nesh-binding protein; ABI gene family member 3-binding protein; ABI gene family, member 3 (NESH) binding protein; FLJ41743; FLJ41754; |
| Gene ID | 25890 |
| mRNA Refseq | NM_015429 |
| Protein Refseq | NP_056244 |
| MIM | 606279 |
| UniProt ID | Q7Z7G0 |
| ◆ Recombinant Proteins | ||
| ABI3BP-3665H | Recombinant Human ABI3BP protein, GST-tagged | +Inquiry |
| ABI3BP-2886H | Recombinant Human ABI3BP protein, His-tagged | +Inquiry |
| ABI3BP-090H | Recombinant Human ABI3BP Protein, GST-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ABI3BP-10HCL | Recombinant Human ABI3BP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABI3BP Products
Required fields are marked with *
My Review for All ABI3BP Products
Required fields are marked with *
