Recombinant Human ABL1 protein(531-650 aa), C-His-tagged
Cat.No. : | ABL1-2499H |
Product Overview : | Recombinant Human ABL1 protein(P00519)(531-650 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 531-650 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | KTRTSRRAAEHRDTTDVPEMPHSKGQGESDPLDHEPAVSPLLPRKERGPPEGGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGQPERRGAGEEEGRDISNGALAFTP |
Gene Name | ABL1 c-abl oncogene 1, non-receptor tyrosine kinase [ Homo sapiens ] |
Official Symbol | ABL1 |
Synonyms | ABL1; c-abl oncogene 1, non-receptor tyrosine kinase; ABL, c abl oncogene 1, receptor tyrosine kinase , v abl Abelson murine leukemia viral oncogene homolog 1; tyrosine-protein kinase ABL1; c ABL; JTK7; p150; proto-oncogene c-Abl; bcr/c-abl oncogene protein; Abelson tyrosine-protein kinase 1; c-abl oncogene 1, receptor tyrosine kinase; proto-oncogene tyrosine-protein kinase ABL1; v-abl Abelson murine leukemia viral oncogene homolog 1; ABL; c-ABL; v-abl; bcr/abl; |
Gene ID | 25 |
mRNA Refseq | NM_005157 |
Protein Refseq | NP_005148 |
MIM | 189980 |
UniProt ID | P00519 |
◆ Native Proteins | ||
ABL1-618H | Native Human C-abl Oncogene 1, Receptor Tyrosine Kinase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABL1-676HCL | Recombinant Human ABL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABL1 Products
Required fields are marked with *
My Review for All ABL1 Products
Required fields are marked with *