Recombinant Human ABL1 protein(531-650 aa), C-His-tagged

Cat.No. : ABL1-2499H
Product Overview : Recombinant Human ABL1 protein(P00519)(531-650 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 531-650 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : KTRTSRRAAEHRDTTDVPEMPHSKGQGESDPLDHEPAVSPLLPRKERGPPEGGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGQPERRGAGEEEGRDISNGALAFTP
Gene Name ABL1 c-abl oncogene 1, non-receptor tyrosine kinase [ Homo sapiens ]
Official Symbol ABL1
Synonyms ABL1; c-abl oncogene 1, non-receptor tyrosine kinase; ABL, c abl oncogene 1, receptor tyrosine kinase , v abl Abelson murine leukemia viral oncogene homolog 1; tyrosine-protein kinase ABL1; c ABL; JTK7; p150; proto-oncogene c-Abl; bcr/c-abl oncogene protein; Abelson tyrosine-protein kinase 1; c-abl oncogene 1, receptor tyrosine kinase; proto-oncogene tyrosine-protein kinase ABL1; v-abl Abelson murine leukemia viral oncogene homolog 1; ABL; c-ABL; v-abl; bcr/abl;
Gene ID 25
mRNA Refseq NM_005157
Protein Refseq NP_005148
MIM 189980
UniProt ID P00519

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABL1 Products

Required fields are marked with *

My Review for All ABL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon