Recombinant Human ABO Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | ABO-2754H |
| Product Overview : | ABO MS Standard C13 and N15-labeled recombinant protein (NP_065202) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes proteins related to the first discovered blood group system, ABO. Variation in the ABO gene (chromosome 9q34.2) is the basis of the ABO blood group, thus the presence of an allele determines the blood group in an individual. The 'O' blood group is caused by a deletion of guanine-258 near the N-terminus of the protein which results in a frameshift and translation of an almost entirely different protein. Individuals with the A, B, and AB alleles express glycosyltransferase activities that convert the H antigen into the A or B antigen. Other minor alleles have been found for this gene. |
| Molecular Mass : | 40.9 kDa |
| AA Sequence : | Tag(s)MAEVLRTLAGKPKCHALRPMILFLIMLVLVLFGYGVLSPRSLMPGSLERGFCMAVREPDHLQRVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | ABO ABO, alpha 1-3-N-acetylgalactosaminyltransferase and alpha 1-3-galactosyltransferase [ Homo sapiens (human) ] |
| Official Symbol | ABO |
| Synonyms | ABO; ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase); histo-blood group ABO system transferase; A3GALNT; A3GALT1; ABO glycosyltransferase; histo-blood group A transferase; histo-blood group B transferase; histo-blood group A2 transferase; B(A) alpha-1,3-galactosyltransferase; fucosylglycoprotein 3-alpha-galactosyltransferase; fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase; glycoprotein-fucosylgalactoside alpha-galactosyltransferase; glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase; GTB; NAGAT; |
| Gene ID | 28 |
| mRNA Refseq | NM_020469 |
| Protein Refseq | NP_065202 |
| MIM | 110300 |
| UniProt ID | P16442 |
| ◆ Recombinant Proteins | ||
| Abo-1479M | Recombinant Mouse Abo Protein, Myc/DDK-tagged | +Inquiry |
| ABO-29H | Recombinant Human ABO Protein (AA 65-354), N-6×His/GFP tagged | +Inquiry |
| ABO-269H | Active Recombinant Human ABO, His-tagged | +Inquiry |
| ABO-6661Z | Recombinant Zebrafish ABO | +Inquiry |
| ABO-605H | Recombinant Human ABO protein, hFc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ABO-9124HCL | Recombinant Human ABO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABO Products
Required fields are marked with *
My Review for All ABO Products
Required fields are marked with *
