Recombinant Human ACACA Protein, GST-Tagged
Cat.No. : | ACACA-126H |
Product Overview : | Human ACACA partial ORF ( NP_942131, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Acetyl-CoA carboxylase (ACC) is a complex multifunctional enzyme system. ACC is a biotin-containing enzyme which catalyzes the carboxylation of acetyl-CoA to malonyl-CoA, the rate-limiting step in fatty acid synthesis. There are two ACC forms, alpha and beta, encoded by two different genes. ACC-alpha is highly enriched in lipogenic tissues. The enzyme is under long term control at the transcriptional and translational levels and under short term regulation by the phosphorylation/dephosphorylation of targeted serine residues and by allosteric transformation by citrate or palmitoyl-CoA. Multiple alternatively spliced transcript variants divergent in the 5' sequence and encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | MWWSTLMSILRARSFWKWISTQTVRIIRAVRAHFGGIMDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ACACA acetyl-CoA carboxylase alpha [ Homo sapiens ] |
Official Symbol | ACACA |
Synonyms | ACACA; acetyl-CoA carboxylase alpha; ACAC, ACC, acetyl Coenzyme A carboxylase alpha; acetyl-CoA carboxylase 1; ACC1; acetyl CoA carboxylase 1; ACC-alpha; acetyl-Coenzyme A carboxylase alpha; ACC; ACAC; ACCA; ACACAD; |
Gene ID | 31 |
mRNA Refseq | NM_198834 |
Protein Refseq | NP_942131 |
MIM | 200350 |
UniProt ID | Q13085 |
◆ Recombinant Proteins | ||
acaca-17Z | Recombinant Zebrafish acaca Protein, His&GST-tagged | +Inquiry |
ACACA-231M | Recombinant Mouse ACACA Protein, His (Fc)-Avi-tagged | +Inquiry |
ACACA-1018M | Recombinant Mouse ACACA Protein, His-tagged | +Inquiry |
ACACA-1850H | Active Recombinant Human ACACA protein, FLAG/His-tagged | +Inquiry |
ACACA-4123H | Recombinant Human ACACA protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACACA Products
Required fields are marked with *
My Review for All ACACA Products
Required fields are marked with *