Recombinant Human ACACA Protein, GST-Tagged

Cat.No. : ACACA-126H
Product Overview : Human ACACA partial ORF ( NP_942131, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Acetyl-CoA carboxylase (ACC) is a complex multifunctional enzyme system. ACC is a biotin-containing enzyme which catalyzes the carboxylation of acetyl-CoA to malonyl-CoA, the rate-limiting step in fatty acid synthesis. There are two ACC forms, alpha and beta, encoded by two different genes. ACC-alpha is highly enriched in lipogenic tissues. The enzyme is under long term control at the transcriptional and translational levels and under short term regulation by the phosphorylation/dephosphorylation of targeted serine residues and by allosteric transformation by citrate or palmitoyl-CoA. Multiple alternatively spliced transcript variants divergent in the 5' sequence and encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.63 kDa
AA Sequence : MWWSTLMSILRARSFWKWISTQTVRIIRAVRAHFGGIMDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ACACA acetyl-CoA carboxylase alpha [ Homo sapiens ]
Official Symbol ACACA
Synonyms ACACA; acetyl-CoA carboxylase alpha; ACAC, ACC, acetyl Coenzyme A carboxylase alpha; acetyl-CoA carboxylase 1; ACC1; acetyl CoA carboxylase 1; ACC-alpha; acetyl-Coenzyme A carboxylase alpha; ACC; ACAC; ACCA; ACACAD;
Gene ID 31
mRNA Refseq NM_198834
Protein Refseq NP_942131
MIM 200350
UniProt ID Q13085

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACACA Products

Required fields are marked with *

My Review for All ACACA Products

Required fields are marked with *

0
cart-icon