Recombinant Human ACACB Protein, GST-Tagged
Cat.No. : | ACACB-127H |
Product Overview : | Human ACACB partial ORF ( NP_001084, 22 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Acetyl-CoA carboxylase (ACC) is a complex multifunctional enzyme system. ACC is a biotin-containing enzyme which catalyzes the carboxylation of acetyl-CoA to malonyl-CoA, the rate-limiting step in fatty acid synthesis. ACC-beta is thought to control fatty acid oxidation by means of the ability of malonyl-CoA to inhibit carnitine-palmitoyl-CoA transferase I, the rate-limiting step in fatty acid uptake and oxidation by mitochondria. ACC-beta may be involved in the regulation of fatty acid oxidation, rather than fatty acid biosynthesis. There is evidence for the presence of two ACC-beta isoforms. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | IWGKMTDSKPITKSKSEANLIPSQEPFPASDNSGETPQRNGEGHTLPKTPSQAEPASHKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPELQANGT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ACACB acetyl-CoA carboxylase beta [ Homo sapiens ] |
Official Symbol | ACACB |
Synonyms | ACACB; acetyl-CoA carboxylase beta; acetyl Coenzyme A carboxylase beta; acetyl-CoA carboxylase 2; ACC2; ACCB; acetyl CoA carboxylase 2; HACC275; ACC-beta; acetyl-Coenzyme A carboxylase beta; |
Gene ID | 32 |
mRNA Refseq | NM_001093 |
Protein Refseq | NP_001084 |
MIM | 601557 |
UniProt ID | O00763 |
◆ Recombinant Proteins | ||
ACACB-1156M | Recombinant Mouse ACACB Protein | +Inquiry |
ACACB-2408H | Recombinant Human ACACB Protein, His (Fc)-Avi-tagged | +Inquiry |
ACACB-1849H | Active Recombinant Human ACACB protein, His-tagged | +Inquiry |
Acacb-21M | Recombinant Mouse Acacb Protein, His-tagged | +Inquiry |
ACACB-541H | Recombinant Human ACACB | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACACB Products
Required fields are marked with *
My Review for All ACACB Products
Required fields are marked with *
0
Inquiry Basket