Recombinant Human ACAD10 Protein, GST-Tagged
Cat.No. : | ACAD10-128H |
Product Overview : | Human ACAD10 full-length ORF ( AAH15056.1, 1 a.a. - 237 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the acyl-CoA dehydrogenase family of enzymes (ACADs), which participate in the beta-oxidation of fatty acids in mitochondria. The encoded enzyme contains a hydrolase domain at the N-terminal portion, a serine/threonine protein kinase catlytic domain in the central region, and a conserved ACAD domain at the C-terminus. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Nov 2008] |
Molecular Mass : | 52.8 kDa |
AA Sequence : | MGGVLIPSPGRVAAEWEVQNRIPSGTILKALMEGGENGPWMRFMRAEITAEGFLREFGRLCSEMLKTSVPVDSFFSLLTSERVAKQFPVMTEAITQIRAKGLQTAVLSNNFYLPNQKSFLPLDRKQFDVIVESCMEGICKPDPRIYKLCLEQLGLQPSESIFLDDLGTNLKEAARLGIHTIKVNDPETAVKELEALLGFTLRVGVPNTRPVKKTMEIPKDSLQKYLKDLLGIQTTGL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ACAD10 acyl-CoA dehydrogenase family, member 10 [ Homo sapiens ] |
Official Symbol | ACAD10 |
Synonyms | ACAD10; acyl-CoA dehydrogenase family, member 10; acyl Coenzyme A dehydrogenase family, member 10; acyl-CoA dehydrogenase family member 10; MGC5601; ACAD-10; acyl-Coenzyme A dehydrogenase family, member 10; |
Gene ID | 80724 |
mRNA Refseq | NM_001136538 |
Protein Refseq | NP_001130010 |
MIM | 611181 |
UniProt ID | Q6JQN1 |
◆ Recombinant Proteins | ||
ACAD10-4756H | Recombinant Human ACAD10 protein, His-tagged | +Inquiry |
ACAD10-128H | Recombinant Human ACAD10 Protein, GST-Tagged | +Inquiry |
ADAMTSL3-3672H | Recombinant Human ADAMTSL3 protein, GST-tagged | +Inquiry |
ACAD10-892HF | Recombinant Full Length Human ACAD10 Protein, GST-tagged | +Inquiry |
ACAD10-233M | Recombinant Mouse ACAD10 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACAD10-14HCL | Recombinant Human ACAD10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACAD10 Products
Required fields are marked with *
My Review for All ACAD10 Products
Required fields are marked with *
0
Inquiry Basket