Recombinant Human ACAD10 Protein, GST-Tagged
| Cat.No. : | ACAD10-128H |
| Product Overview : | Human ACAD10 full-length ORF ( AAH15056.1, 1 a.a. - 237 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the acyl-CoA dehydrogenase family of enzymes (ACADs), which participate in the beta-oxidation of fatty acids in mitochondria. The encoded enzyme contains a hydrolase domain at the N-terminal portion, a serine/threonine protein kinase catlytic domain in the central region, and a conserved ACAD domain at the C-terminus. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Nov 2008] |
| Molecular Mass : | 52.8 kDa |
| AA Sequence : | MGGVLIPSPGRVAAEWEVQNRIPSGTILKALMEGGENGPWMRFMRAEITAEGFLREFGRLCSEMLKTSVPVDSFFSLLTSERVAKQFPVMTEAITQIRAKGLQTAVLSNNFYLPNQKSFLPLDRKQFDVIVESCMEGICKPDPRIYKLCLEQLGLQPSESIFLDDLGTNLKEAARLGIHTIKVNDPETAVKELEALLGFTLRVGVPNTRPVKKTMEIPKDSLQKYLKDLLGIQTTGL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ACAD10 acyl-CoA dehydrogenase family, member 10 [ Homo sapiens ] |
| Official Symbol | ACAD10 |
| Synonyms | ACAD10; acyl-CoA dehydrogenase family, member 10; acyl Coenzyme A dehydrogenase family, member 10; acyl-CoA dehydrogenase family member 10; MGC5601; ACAD-10; acyl-Coenzyme A dehydrogenase family, member 10; |
| Gene ID | 80724 |
| mRNA Refseq | NM_001136538 |
| Protein Refseq | NP_001130010 |
| MIM | 611181 |
| UniProt ID | Q6JQN1 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACAD10 Products
Required fields are marked with *
My Review for All ACAD10 Products
Required fields are marked with *
