Recombinant Human ACAD10 Protein, GST-Tagged

Cat.No. : ACAD10-128H
Product Overview : Human ACAD10 full-length ORF ( AAH15056.1, 1 a.a. - 237 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the acyl-CoA dehydrogenase family of enzymes (ACADs), which participate in the beta-oxidation of fatty acids in mitochondria. The encoded enzyme contains a hydrolase domain at the N-terminal portion, a serine/threonine protein kinase catlytic domain in the central region, and a conserved ACAD domain at the C-terminus. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Nov 2008]
Molecular Mass : 52.8 kDa
AA Sequence : MGGVLIPSPGRVAAEWEVQNRIPSGTILKALMEGGENGPWMRFMRAEITAEGFLREFGRLCSEMLKTSVPVDSFFSLLTSERVAKQFPVMTEAITQIRAKGLQTAVLSNNFYLPNQKSFLPLDRKQFDVIVESCMEGICKPDPRIYKLCLEQLGLQPSESIFLDDLGTNLKEAARLGIHTIKVNDPETAVKELEALLGFTLRVGVPNTRPVKKTMEIPKDSLQKYLKDLLGIQTTGL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ACAD10 acyl-CoA dehydrogenase family, member 10 [ Homo sapiens ]
Official Symbol ACAD10
Synonyms ACAD10; acyl-CoA dehydrogenase family, member 10; acyl Coenzyme A dehydrogenase family, member 10; acyl-CoA dehydrogenase family member 10; MGC5601; ACAD-10; acyl-Coenzyme A dehydrogenase family, member 10;
Gene ID 80724
mRNA Refseq NM_001136538
Protein Refseq NP_001130010
MIM 611181
UniProt ID Q6JQN1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACAD10 Products

Required fields are marked with *

My Review for All ACAD10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon