Recombinant Human ACBD6 Protein, GST-Tagged

Cat.No. : ACBD6-150H
Product Overview : Human ACBD6 full-length ORF ( NP_115736.1, 1 a.a. - 282 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ACBD6 (Acyl-CoA Binding Domain Containing 6) is a Protein Coding gene. Among its related pathways are Metabolism and Fatty Acyl-CoA Biosynthesis. GO annotations related to this gene include lipid binding and fatty-acyl-CoA binding.
Molecular Mass : 61.2 kDa
AA Sequence : MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLRRVTGWKEQVVNGDVGAVSEPPCLPKEPAPPSPESHSPRDLDSEVFCDSLEQLEPELVWTEQRAASGGKRDPRNSPVPPTKKEGLRGSPPGPQELDVWLLGTVRALQESMQEVQARVQSLESMPRPPEQRPQPRPSARPWPLGLPGPALLFFLLWPFVVQWLFRMFRTQKR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ACBD6 acyl-CoA binding domain containing 6 [ Homo sapiens ]
Official Symbol ACBD6
Synonyms ACBD6; acyl-CoA binding domain containing 6; acyl Coenzyme A binding domain containing 6; acyl-CoA-binding domain-containing protein 6; MGC2404; acyl-Coenzyme A binding domain containing 6;
Gene ID 84320
mRNA Refseq NM_032360
Protein Refseq NP_115736
UniProt ID Q9BR61

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACBD6 Products

Required fields are marked with *

My Review for All ACBD6 Products

Required fields are marked with *

0
cart-icon
0
compare icon