Recombinant Human ACBD6 Protein, GST-Tagged

• Cat.No.: ACBD6-150H
• Product Overview: Human ACBD6 full-length ORF ( NP_115736.1, 1 a.a. - 282 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ACBD6 (Acyl-CoA Binding Domain Containing 6) is a Protein Coding gene. Among its related pathways are Metabolism and Fatty Acyl-CoA Biosynthesis. GO annotations related to this gene include lipid binding and fatty-acyl-CoA binding.
• Molecular Mass: 61.2 kDa
• AA Sequence: MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLRRVTGWKEQVVNGDVGAVSEPPCLPKEPAPPSPESHSPRDLDSEVFCDSLEQLEPELVWTEQRAASGGKRDPRNSPVPPTKKEGLRGSPPGPQELDVWLLGTVRALQESMQEVQARVQSLESMPRPPEQRPQPRPSARPWPLGLPGPALLFFLLWPFVVQWLFRMFRTQKR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ACBD6 acyl-CoA binding domain containing 6 [ Homo sapiens ]
• Official Symbol: ACBD6
• Synonyms: ACBD6; acyl-CoA binding domain containing 6; acyl Coenzyme A binding domain containing 6; acyl-CoA-binding domain-containing protein 6; MGC2404; acyl-Coenzyme A binding domain containing 6
• Gene ID: 84320
• mRNA Refseq: NM_032360
• Protein Refseq: NP_115736
• UniProt ID: Q9BR61