Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human ACCN2

Cat.No. : ACCN2-26289TH
Product Overview : Recombinant full length Human ACCN2 with N terminal proprietary tag; Predicted MWt 84.15 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, 2 hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. The member encoded by this gene is expressed in most if not all brain neurons, and it may be an ion channel subunit; however, its function as an ion channel remains unknown. Alternative splicing of this gene generates 2 transcript products.
Protein length : 528 amino acids
Molecular Weight : 84.150kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed in most or all neurons.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLS LKRALWALCFLGSLAVLLCVCTERVQYYFHYHHVTKLDEV AASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNN RYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDR AGHDIRDMLLSCHFRGEVCSAEDFKVVFTRYGKCYTFNSG RDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETS FEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRL IYLPPPWGTCKAVTMDSDLDFFDSYSITACRIDCETRYLV ENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQEY CVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQY IGENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMG LFIGASILTVLELFDYAYEVIKHKLCRRGKCQKEAKRSSA DKGVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPAR GTFEDFTC
Sequence Similarities : Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. ACCN2 subfamily.
Gene Name : ACCN2 amiloride-sensitive cation channel 2, neuronal [ Homo sapiens ]
Official Symbol : ACCN2
Synonyms : ACCN2; amiloride-sensitive cation channel 2, neuronal; ASIC1; BNaC2; hBNaC2;
Gene ID : 41
mRNA Refseq : NM_001095
Protein Refseq : NP_001086
MIM : 602866
Uniprot ID : P78348
Chromosome Location : 12q12
Function : ion channel activity; ligand-gated sodium channel activity; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (10)

Ask a question
What is the recommended concentration of the recombinant ACCN2 protein for my experimental application? 10/10/2022

It varies depending on the specific experimental application. You can seek technical support from our experts for guidance on the appropriate protein concentration for your desired assay or study.

What applications have been validated for the recombinant ACCN2 protein? 09/15/2022

Common applications may include biochemical assays, protein-protein interaction studies, functional studies, or as an antigen for antibody development.

Do you offer technical support or assistance for experimental design or troubleshooting? 08/12/2022

Yes, we have a team of technical experts who can help.

Do you have primary antibodies for ACCN2? 09/03/2021

No, but please feel free to submit any specific requirements, and our team of experts will reach out to you accordingly.

Is it possible to request customized recombinant ACCN2 proteins incorporating potential hotspot mutations? 08/02/2021

Certainly, you have the option to provide detailed information about the mutation site in the online form, and our team of scientists will customize the appropriate protein products exclusively for your needs.

Could you please provide information on the endotoxin level testing method used for recombinant ACCN2 protein? 06/18/2021

The endotoxin level of our recombinant protein is assessed through the widely employed Limulus amebocyte lysate (LAL) assay. When filling out the inquiry form, you have the option to specify the desired endotoxin levels for the recombinant ACCN2 protein.

Our high-purity recombinant proteins are ideal for various biophysics-related research purposes, including structural elucidation, molecular dynamics simulations, and interaction studies. 09/18/2020

Our high-purity recombinant proteins is ideal for various biophysics-related research purposes, including structural elucidation, molecular dynamics simulations, and interaction studies.

What is the tissue distribution pattern of ACCN2? 08/12/2020

ACCN2 is widely expressed in the central nervous system, particularly in regions associated with sensory perception and pain processing, such as the dorsal root ganglia, trigeminal ganglia, and spinal cord. It is also found in other tissues like the heart, lungs, gastrointestinal tract, and kidney.

What is the functional role of ACCN2 in the nervous system? 09/11/2019

ACCN2 has been implicated in neuronal processes, including synaptic transmission, pain perception, and modulation of neuronal excitability. It is involved in acid-induced currents in sensory neurons, contributing to the detection and transmission of acidic stimuli.

How do you ensure the activity and quality of Recombinant ACCN2 Protein? 07/31/2016

We employ rigorous quality control measures to ensure the activity and quality of recombinant protein products. These measures may include functional assays to assess the protein's ability to perform its intended biological function. Additionally, analytical techniques such as SDS-PAGE and mass spectrometry are used to verify the protein's identity and confirm its integrity.

Customer Reviews (3)

Write a review
Reviews
05/13/2023

    The high purity of Creative BioMart's recombinant ACCN2 protein made it ideal for my downstream applications.

    11/30/2022

      I am glad I chose the recombinant ACCN2 protein from Creative BioMart. It met all my research needs and was of excellent quality.

      12/01/2018

        The recombinant protein product was well-packaged and delivered promptly. I had a great experience purchasing from Creative BioMart.

        Ask a Question for All ACCN2 Products

        Required fields are marked with *

        My Review for All ACCN2 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends