Recombinant Human ACCN2
Cat.No. : | ACCN2-26289TH |
Product Overview : | Recombinant full length Human ACCN2 with N terminal proprietary tag; Predicted MWt 84.15 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, 2 hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. The member encoded by this gene is expressed in most if not all brain neurons, and it may be an ion channel subunit; however, its function as an ion channel remains unknown. Alternative splicing of this gene generates 2 transcript products. |
Protein length : | 528 amino acids |
Molecular Weight : | 84.150kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Expressed in most or all neurons. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLS LKRALWALCFLGSLAVLLCVCTERVQYYFHYHHVTKLDEV AASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNN RYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDR AGHDIRDMLLSCHFRGEVCSAEDFKVVFTRYGKCYTFNSG RDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETS FEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRL IYLPPPWGTCKAVTMDSDLDFFDSYSITACRIDCETRYLV ENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQEY CVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQY IGENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMG LFIGASILTVLELFDYAYEVIKHKLCRRGKCQKEAKRSSA DKGVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPAR GTFEDFTC |
Sequence Similarities : | Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. ACCN2 subfamily. |
Gene Name : | ACCN2 amiloride-sensitive cation channel 2, neuronal [ Homo sapiens ] |
Official Symbol : | ACCN2 |
Synonyms : | ACCN2; amiloride-sensitive cation channel 2, neuronal; ASIC1; BNaC2; hBNaC2; |
Gene ID : | 41 |
mRNA Refseq : | NM_001095 |
Protein Refseq : | NP_001086 |
MIM : | 602866 |
Uniprot ID : | P78348 |
Chromosome Location : | 12q12 |
Function : | ion channel activity; ligand-gated sodium channel activity; protein binding; |
Products Types
◆ Recombinant Protein | ||
ACCN2-33R | Recombinant Rhesus Macaque ACCN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACCN2-204R | Recombinant Rhesus monkey ACCN2 Protein, His-tagged | +Inquiry |
ACCN2-3416C | Recombinant Chicken ACCN2 | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (10)
Ask a questionIt varies depending on the specific experimental application. You can seek technical support from our experts for guidance on the appropriate protein concentration for your desired assay or study.
Common applications may include biochemical assays, protein-protein interaction studies, functional studies, or as an antigen for antibody development.
Yes, we have a team of technical experts who can help.
No, but please feel free to submit any specific requirements, and our team of experts will reach out to you accordingly.
Certainly, you have the option to provide detailed information about the mutation site in the online form, and our team of scientists will customize the appropriate protein products exclusively for your needs.
The endotoxin level of our recombinant protein is assessed through the widely employed Limulus amebocyte lysate (LAL) assay. When filling out the inquiry form, you have the option to specify the desired endotoxin levels for the recombinant ACCN2 protein.
Our high-purity recombinant proteins is ideal for various biophysics-related research purposes, including structural elucidation, molecular dynamics simulations, and interaction studies.
ACCN2 is widely expressed in the central nervous system, particularly in regions associated with sensory perception and pain processing, such as the dorsal root ganglia, trigeminal ganglia, and spinal cord. It is also found in other tissues like the heart, lungs, gastrointestinal tract, and kidney.
ACCN2 has been implicated in neuronal processes, including synaptic transmission, pain perception, and modulation of neuronal excitability. It is involved in acid-induced currents in sensory neurons, contributing to the detection and transmission of acidic stimuli.
We employ rigorous quality control measures to ensure the activity and quality of recombinant protein products. These measures may include functional assays to assess the protein's ability to perform its intended biological function. Additionally, analytical techniques such as SDS-PAGE and mass spectrometry are used to verify the protein's identity and confirm its integrity.
Customer Reviews (3)
Write a reviewThe high purity of Creative BioMart's recombinant ACCN2 protein made it ideal for my downstream applications.
I am glad I chose the recombinant ACCN2 protein from Creative BioMart. It met all my research needs and was of excellent quality.
The recombinant protein product was well-packaged and delivered promptly. I had a great experience purchasing from Creative BioMart.
Ask a Question for All ACCN2 Products
Required fields are marked with *
My Review for All ACCN2 Products
Required fields are marked with *
Inquiry Basket