Recombinant Human ACMSD Protein, His-tagged
| Cat.No. : | ACMSD-10H |
| Product Overview : | Recombinant Human ACMSD Protein(Q8TDX5)(Pro11-Leu330), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Pro11-Leu330 |
| Form : | Phosphate buffered saline |
| Storage : | Store at -20 to -80°C. |
| Molecular Mass : | 38 kDa |
| AA Sequence : | PKEWPDLKKRFGYGGWVQLQHHSKGEAKLLKDGKVFRVVRENCWDPEVRIREMDQKGVTVQALSTVPVMFSYWAKPEDTLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQAPELAVKEMERCVKELGFPGVQIGTHVNEWDLNAQELFPVYAAAERLKCSLFVHPWDMQMDGRMAKYWLPWLVGMPAETTIAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGFSMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELEPGKLIESMEEFDEETKNKLKAGNALAFLGL |
| Official Symbol | ACMSD |
| Synonyms | ACMSD; aminocarboxymuconate semialdehyde decarboxylase; 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase; picolinate carboxylase; |
| Gene ID | 130013 |
| mRNA Refseq | NM_138326 |
| Protein Refseq | NP_612199 |
| MIM | 608889 |
| UniProt ID | Q8TDX5 |
| ◆ Recombinant Proteins | ||
| ACMSD-910H | Recombinant Human ACMSD Protein, MYC/DDK-tagged | +Inquiry |
| ACMSD-451R | Recombinant Rat ACMSD Protein | +Inquiry |
| ACMSD-253M | Recombinant Mouse ACMSD Protein, His (Fc)-Avi-tagged | +Inquiry |
| ACMSD-1720H | Recombinant Human ACMSD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ACMSD-655HFL | Recombinant Full Length Human ACMSD Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACMSD-5HCL | Recombinant Human ACMSD lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACMSD Products
Required fields are marked with *
My Review for All ACMSD Products
Required fields are marked with *
