Recombinant Human ACOX3 Protein, GST-Tagged

Cat.No. : ACOX3-176H
Product Overview : Human ACOX3 partial ORF ( NP_003492, 632 a.a. - 700 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Acyl-Coenzyme A oxidase 3 also know as pristanoyl -CoA oxidase (ACOX3)is involved in the desaturation of 2-methyl branched fatty acids in peroxisomes. Unlike the rat homolog, the human gene is expressed in very low amounts in liver such that its mRNA was undetectable by routine Northern-blot analysis or its product by immunoblotting or by enzyme activity measurements. However the human cDNA encoding a 700 amino acid protein with a peroxisomal targeting C-terminal tripeptide S-K-L was isolated and is thought to be expressed under special conditions such as specific developmental stages or in a tissue specific manner in tissues that have not yet been examined. [provided by RefSeq, Jul 2008]
Molecular Mass : 33.33 kDa
AA Sequence : QLKDDAVALVDVIAPPDFVLDSPIGRADGELYKNLWGAVLQESKVLERASWWPEFSVNKPVIGSLKSKL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ACOX3 acyl-CoA oxidase 3, pristanoyl [ Homo sapiens ]
Official Symbol ACOX3
Synonyms ACOX3; acyl-CoA oxidase 3, pristanoyl; acyl Coenzyme A oxidase 3, pristanoyl; peroxisomal acyl-coenzyme A oxidase 3; BRCACox; pristanoyl-CoA oxidase; branched-chain acyl-CoA oxidase; acyl-Coenzyme A oxidase 3, pristanoyl;
Gene ID 8310
mRNA Refseq NM_001101667
Protein Refseq NP_001095137
MIM 603402
UniProt ID O15254

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACOX3 Products

Required fields are marked with *

My Review for All ACOX3 Products

Required fields are marked with *

0
cart-icon
0
compare icon