Recombinant Human ACOX3 Protein, GST-Tagged
| Cat.No. : | ACOX3-176H |
| Product Overview : | Human ACOX3 partial ORF ( NP_003492, 632 a.a. - 700 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Acyl-Coenzyme A oxidase 3 also know as pristanoyl -CoA oxidase (ACOX3)is involved in the desaturation of 2-methyl branched fatty acids in peroxisomes. Unlike the rat homolog, the human gene is expressed in very low amounts in liver such that its mRNA was undetectable by routine Northern-blot analysis or its product by immunoblotting or by enzyme activity measurements. However the human cDNA encoding a 700 amino acid protein with a peroxisomal targeting C-terminal tripeptide S-K-L was isolated and is thought to be expressed under special conditions such as specific developmental stages or in a tissue specific manner in tissues that have not yet been examined. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 33.33 kDa |
| AA Sequence : | QLKDDAVALVDVIAPPDFVLDSPIGRADGELYKNLWGAVLQESKVLERASWWPEFSVNKPVIGSLKSKL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ACOX3 acyl-CoA oxidase 3, pristanoyl [ Homo sapiens ] |
| Official Symbol | ACOX3 |
| Synonyms | ACOX3; acyl-CoA oxidase 3, pristanoyl; acyl Coenzyme A oxidase 3, pristanoyl; peroxisomal acyl-coenzyme A oxidase 3; BRCACox; pristanoyl-CoA oxidase; branched-chain acyl-CoA oxidase; acyl-Coenzyme A oxidase 3, pristanoyl; |
| Gene ID | 8310 |
| mRNA Refseq | NM_001101667 |
| Protein Refseq | NP_001095137 |
| MIM | 603402 |
| UniProt ID | O15254 |
| ◆ Recombinant Proteins | ||
| ACOX3-5020H | Recombinant Human ACOX3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Acox3-1503M | Recombinant Mouse Acox3 Protein, Myc/DDK-tagged | +Inquiry |
| ACOX3-175H | Recombinant Human ACOX3 Protein, GST-Tagged | +Inquiry |
| PRKAA1-3871H | Recombinant Human PRKAA1 protein, His-tagged | +Inquiry |
| ACOX3-116R | Recombinant Rat ACOX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACOX3 Products
Required fields are marked with *
My Review for All ACOX3 Products
Required fields are marked with *
