Recombinant Human ACP7 Protein, GST-tagged
| Cat.No. : | ACP7-4252H |
| Product Overview : | Human FLJ16165 full-length ORF (BAD18425.1, 1 a.a. - 438 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Purple acid phosphatases (PAPs), including PAPL, are a family of binuclear metallohydrolases that have been identified in plants, animals, and fungi (Flanagan et al., 2006 [PubMed 16793224]).[supplied by OMIM |
| Molecular Mass : | 76.9 kDa |
| AA Sequence : | MHPLPGYWSCYCLLLLFSLGVQGSLGAPSAAPEQVHLSYPGEPGSMTVTWTTWVPTRSEVQFGLQPSGPLPLRAQGTFVPFVDGGILRRKLYIHRVTLRKLLPGVQYVYRCGSAQGWSRRFRFRALKNGAHWSPRLAVFGDLGADNPKAVPRLRRDTQQGMYDAVLHVGDFAYNLDQDNARVGDRFMRLIEPVAASLPYMTCPGNHEERYNFSNYKARFSMPGDNEGLWYSWDLGPAHIISFSTEVYFFLHYGRHLVQRQFRWLESDLQKANKNRAARPWIITMGHRPMYCSNADLDDCTRHESKVRKGLQGKLYGLEDLFYKYGVDLQLWAHEHSYERLWPIYNYQVFNGSREMPYTNPRGPVHIITGSAGCEERLTPFAVFPRPWSAVRVKEYGYTRLHILNGTHTHIQQVSDDQDGKIVDDVWVVRPLFGRRMYL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ACP7 acid phosphatase 7, tartrate resistant (putative) [ Homo sapiens (human) ] |
| Official Symbol | ACP7 |
| Synonyms | ACP7; acid phosphatase 7, tartrate resistant (putative); PAPL; PAPL1; acid phosphatase type 7; iron/zinc purple acid phosphatase-like protein; purple acid phosphatase long form 1; EC 3.1.3.2 |
| Gene ID | 390928 |
| mRNA Refseq | NM_001004318 |
| Protein Refseq | NP_001004318 |
| MIM | 610490 |
| UniProt ID | Q6ZNF0 |
| ◆ Recombinant Proteins | ||
| ACP7-4252H | Recombinant Human ACP7 Protein, GST-tagged | +Inquiry |
| ACP7-4874HF | Recombinant Full Length Human ACP7 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACP7 Products
Required fields are marked with *
My Review for All ACP7 Products
Required fields are marked with *
