Recombinant Human ACRV1 protein, His-SUMO-tagged
Cat.No. : | ACRV1-2479H |
Product Overview : | Recombinant Human ACRV1 protein(P26436)(22-265aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 22-265aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 41.8 kDa |
AA Sequence : | QPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | ACRV1 acrosomal vesicle protein 1 [ Homo sapiens ] |
Official Symbol | ACRV1 |
Synonyms | ACRV1; acrosomal vesicle protein 1; acrosomal protein SP-10; D11S4365; SP 10; SPACA2; sperm protein 10; SP-10; |
Gene ID | 56 |
mRNA Refseq | NM_001612 |
Protein Refseq | NP_001603 |
MIM | 102525 |
UniProt ID | P26436 |
◆ Recombinant Proteins | ||
ACRV1-2640H | Recombinant Human ACRV1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ACRV1-1220M | Recombinant Mouse ACRV1 Protein | +Inquiry |
ACRV1-5398H | Recombinant Human ACRV1 Protein (Gln22-Ile265), C-His tagged | +Inquiry |
Acrv1-518M | Recombinant Mouse Acrv1 Protein, MYC/DDK-tagged | +Inquiry |
ACRV1-383H | Recombinant Human ACRV1 Protein, GST-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACRV1-2105HCL | Recombinant Human ACRV1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACRV1 Products
Required fields are marked with *
My Review for All ACRV1 Products
Required fields are marked with *