Recombinant Human ACRV1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ACRV1-2640H
Product Overview : ACRV1 MS Standard C13 and N15-labeled recombinant protein (NP_064495) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration. Alternatively spliced transcript variants have been described.
Molecular Mass : 11.2 kDa
AA Sequence : MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ACRV1 acrosomal vesicle protein 1 [ Homo sapiens (human) ]
Official Symbol ACRV1
Synonyms ACRV1; acrosomal vesicle protein 1; acrosomal protein SP-10; D11S4365; SP 10; SPACA2; sperm protein 10; SP-10;
Gene ID 56
mRNA Refseq NM_020110
Protein Refseq NP_064495
MIM 102525
UniProt ID P26436

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACRV1 Products

Required fields are marked with *

My Review for All ACRV1 Products

Required fields are marked with *

0
cart-icon