Recombinant Human ACRV1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ACRV1-2640H |
Product Overview : | ACRV1 MS Standard C13 and N15-labeled recombinant protein (NP_064495) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration. Alternatively spliced transcript variants have been described. |
Molecular Mass : | 11.2 kDa |
AA Sequence : | MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ACRV1 acrosomal vesicle protein 1 [ Homo sapiens (human) ] |
Official Symbol | ACRV1 |
Synonyms | ACRV1; acrosomal vesicle protein 1; acrosomal protein SP-10; D11S4365; SP 10; SPACA2; sperm protein 10; SP-10; |
Gene ID | 56 |
mRNA Refseq | NM_020110 |
Protein Refseq | NP_064495 |
MIM | 102525 |
UniProt ID | P26436 |
◆ Recombinant Proteins | ||
ACRV1-3785H | Recombinant Human ACRV1 protein, His-tagged | +Inquiry |
ACRV1-1220M | Recombinant Mouse ACRV1 Protein | +Inquiry |
ACRV1-5398H | Recombinant Human ACRV1 Protein (Gln22-Ile265), C-His tagged | +Inquiry |
ACRV1-190H | Recombinant Human ACRV1 Protein, GST-Tagged | +Inquiry |
ACRV1-6002H | Recombinant Human ACRV1 Protein (Met1-Ile265), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACRV1-2105HCL | Recombinant Human ACRV1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACRV1 Products
Required fields are marked with *
My Review for All ACRV1 Products
Required fields are marked with *