Recombinant Human ACRV1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | ACRV1-2640H | 
| Product Overview : | ACRV1 MS Standard C13 and N15-labeled recombinant protein (NP_064495) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | HEK293 | 
| Tag : | DDK&Myc | 
| Description : | This gene encodes a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration. Alternatively spliced transcript variants have been described. | 
| Molecular Mass : | 11.2 kDa | 
| AA Sequence : | MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKITRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. | 
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. | 
| Concentration : | 50 μg/mL as determined by BCA | 
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. | 
| Gene Name | ACRV1 acrosomal vesicle protein 1 [ Homo sapiens (human) ] | 
| Official Symbol | ACRV1 | 
| Synonyms | ACRV1; acrosomal vesicle protein 1; acrosomal protein SP-10; D11S4365; SP 10; SPACA2; sperm protein 10; SP-10; | 
| Gene ID | 56 | 
| mRNA Refseq | NM_020110 | 
| Protein Refseq | NP_064495 | 
| MIM | 102525 | 
| UniProt ID | P26436 | 
| ◆ Recombinant Proteins | ||
| ACRV1-383H | Recombinant Human ACRV1 Protein, GST-His-tagged | +Inquiry | 
| ACRV1-5398H | Recombinant Human ACRV1 Protein (Gln22-Ile265), C-His tagged | +Inquiry | 
| Acrv1-518M | Recombinant Mouse Acrv1 Protein, MYC/DDK-tagged | +Inquiry | 
| Acrv1-3083M | Recombinant Mouse Acrv1, His-tagged | +Inquiry | 
| ACRV1-1805H | Recombinant Human ACRV1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| ACRV1-2105HCL | Recombinant Human ACRV1 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACRV1 Products
Required fields are marked with *
My Review for All ACRV1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            