Recombinant Human ACSBG1 protein, His-tagged
| Cat.No. : | ACSBG1-3948H |
| Product Overview : | Recombinant Human ACSBG1 protein(404-686 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 06, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 404-686 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | AMSVTLEQNLTCPGSDLKPFTTRLADYLVLAKVRQALGFAKCQKNFYGAAPMMAETQHFFLGLNIRLYAGYGLSETSGPHFMSSPYNYRLYSSGKLVPGCRVKLVNQDAEGIGEICLWGRTIFMGYLNMEDKTCEAIDEEGWLHTGDAGRLDADGFLYITGRLKELIITAGGENVPPVPIEEAVKMELPIISNAMLIGDQRKFLSMLLTLKCTLDPDTSDQTDNLTEQAVEFCQRVGSRATTVSEIIEKKDEAVYQAIEEGIRRVNMNAAARPYHIQKWAILE |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ACSBG1 acyl-CoA synthetase bubblegum family member 1 [ Homo sapiens ] |
| Official Symbol | ACSBG1 |
| Synonyms | ACSBG1; acyl-CoA synthetase bubblegum family member 1; long-chain-fatty-acid--CoA ligase ACSBG1; BG1; BGM; bubblegum; FLJ30320; hBG1; hsBG; KIAA0631; lipidosin; MGC14352; very long chain acyl CoA synthetase; very long-chain acyl-CoA synthetase; BG; LPD; GR-LACS; |
| Gene ID | 23205 |
| mRNA Refseq | NM_001199377 |
| Protein Refseq | NP_001186306 |
| MIM | 614362 |
| UniProt ID | Q96GR2 |
| ◆ Recombinant Proteins | ||
| ACSBG1-1221M | Recombinant Mouse ACSBG1 Protein | +Inquiry |
| ACSBG1-269M | Recombinant Mouse ACSBG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Acsbg1-1259M | Recombinant Mouse Acsbg1 Protein, His-tagged | +Inquiry |
| ACSBG1-191H | Recombinant Human ACSBG1 Protein, GST-tagged | +Inquiry |
| ACSBG1-3948H | Recombinant Human ACSBG1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACSBG1-9079HCL | Recombinant Human ACSBG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACSBG1 Products
Required fields are marked with *
My Review for All ACSBG1 Products
Required fields are marked with *
