Recombinant Human ACSL1 Protein, GST-tagged
| Cat.No. : | ACSL1-195H |
| Product Overview : | Human ACSL1 partial ORF ( NP_001986, 48 a.a. - 145 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme preferentially utilizes arachidonate as substrate. The absence of this enzyme may contribute to the mental retardation or Alport syndrome. Alternative splicing of this gene generates multiple transcript variants. [provided by RefSeq, Jan 2016] |
| Molecular Mass : | 36.52 kDa |
| AA Sequence : | PKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ACSL1 acyl-CoA synthetase long-chain family member 1 [ Homo sapiens ] |
| Official Symbol | ACSL1 |
| Synonyms | ACSL1; acyl-CoA synthetase long-chain family member 1; FACL2, fatty acid Coenzyme A ligase, long chain 2; long-chain-fatty-acid--CoA ligase 1; ACS1; FACL1; LACS; LACS1; LACS2; lignoceroyl CoA synthase; long chain fatty acid coenzyme A ligase 1; LACS 1; LACS 2; acyl-CoA synthetase 1; palmitoyl-CoA ligase 1; palmitoyl-CoA ligase 2; paltimoyl-CoA ligase 1; lignoceroyl-CoA synthase; long-chain acyl-CoA synthetase 1; long-chain acyl-CoA synthetase 2; long-chain fatty acid-CoA ligase 2; long-chain fatty-acid-coenzyme A ligase 1; fatty-acid-Coenzyme A ligase, long-chain 1; fatty-acid-Coenzyme A ligase, long-chain 2; FACL2; |
| Gene ID | 2180 |
| mRNA Refseq | NM_001995 |
| Protein Refseq | NP_001986 |
| MIM | 152425 |
| UniProt ID | P33121 |
| ◆ Recombinant Proteins | ||
| ACSL1-1950C | Recombinant Chicken ACSL1 | +Inquiry |
| ACSL1-2849HCL | Recombinant Human ACSL1 lysate, Myc/DDK-tagged | +Inquiry |
| ACSL1-195H | Recombinant Human ACSL1 Protein, GST-tagged | +Inquiry |
| ACSL1-26479TH | Recombinant Human ACSL1 | +Inquiry |
| RFL-33045MF | Recombinant Full Length Mouse Long-Chain-Fatty-Acid--Coa Ligase 1(Acsl1) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACSL1 Products
Required fields are marked with *
My Review for All ACSL1 Products
Required fields are marked with *
