Recombinant Human ACSS1 Protein, GST-tagged
Cat.No. : | ACSS1-208H |
Product Overview : | Human ACSS1 full-length ORF (BAC03530.1, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a mitochondrial acetyl-CoA synthetase enzyme. A similar protein in mice plays an important role in the tricarboxylic acid cycle by catalyzing the conversion of acetate to acetyl CoA. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2011] |
Molecular Mass : | 43.7 kDa |
AA Sequence : | MKLKCIFGFATKETSCYNVTNIGFKSPSDFWQSVHSTLPRELAPCLVFNTSPNLALFSAAFAFIVVKDSAGDSDVVVQELKSMVATKIAKYAVPDEILVVKRLPKTRSGKVMRRLLRKIITSEAQELGDTTTLEDPSIIAEILSVYQKCKDKQAAAK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ACSS1 acyl-CoA synthetase short-chain family member 1 [ Homo sapiens ] |
Official Symbol | ACSS1 |
Synonyms | ACSS1; acyl-CoA synthetase short-chain family member 1; ACAS2L, acetyl Coenzyme A synthetase 2 (AMP forming) like; acetyl-coenzyme A synthetase 2-like, mitochondrial; AceCS2L; dJ568C11.3; MGC33843; acetate--CoA ligase 2; ACAS2L; ACECS1; FLJ45659; |
Gene ID | 84532 |
mRNA Refseq | NM_001252675 |
Protein Refseq | NP_001239604 |
MIM | 614355 |
UniProt ID | Q9NUB1 |
◆ Recombinant Proteins | ||
ACSS1-2163H | Recombinant Human ACSS1 Protein (38-689 aa), His-tagged | +Inquiry |
Acss1-66M | Recombinant Mouse Acss1 Protein, His-tagged | +Inquiry |
ACSS1-263H | Recombinant Human ACSS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACSS1-9327H | Recombinant Human ACSS1 protein, His-tagged | +Inquiry |
ACSS1-812HF | Recombinant Full Length Human ACSS1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACSS1-19HCL | Recombinant Human ACSS1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACSS1 Products
Required fields are marked with *
My Review for All ACSS1 Products
Required fields are marked with *
0
Inquiry Basket