Recombinant Human ACSS1 Protein, GST-tagged

Cat.No. : ACSS1-208H
Product Overview : Human ACSS1 full-length ORF (BAC03530.1, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a mitochondrial acetyl-CoA synthetase enzyme. A similar protein in mice plays an important role in the tricarboxylic acid cycle by catalyzing the conversion of acetate to acetyl CoA. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2011]
Molecular Mass : 43.7 kDa
AA Sequence : MKLKCIFGFATKETSCYNVTNIGFKSPSDFWQSVHSTLPRELAPCLVFNTSPNLALFSAAFAFIVVKDSAGDSDVVVQELKSMVATKIAKYAVPDEILVVKRLPKTRSGKVMRRLLRKIITSEAQELGDTTTLEDPSIIAEILSVYQKCKDKQAAAK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ACSS1 acyl-CoA synthetase short-chain family member 1 [ Homo sapiens ]
Official Symbol ACSS1
Synonyms ACSS1; acyl-CoA synthetase short-chain family member 1; ACAS2L, acetyl Coenzyme A synthetase 2 (AMP forming) like; acetyl-coenzyme A synthetase 2-like, mitochondrial; AceCS2L; dJ568C11.3; MGC33843; acetate--CoA ligase 2; ACAS2L; ACECS1; FLJ45659;
Gene ID 84532
mRNA Refseq NM_001252675
Protein Refseq NP_001239604
MIM 614355
UniProt ID Q9NUB1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACSS1 Products

Required fields are marked with *

My Review for All ACSS1 Products

Required fields are marked with *

0
cart-icon