Recombinant Human ACSS2 protein, His-tagged
Cat.No. : | ACSS2-4019H |
Product Overview : | Recombinant Human ACSS2 protein(18-191 aa), fused to His tag, was expressed in E. coli. |
Availability | August 23, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 18-191 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | ALHSIVFAGFSSESLCERILDSSCSLLITTDAFYRGEKLVNLKELADEALQKCQEKGFPVRCCIVVKHLGRAELGMGDSTSQSPPIKRSCPDVQISWNQGIDLWWHELMQEAGDECEPEWCDAEDPLFILYTSGSTGKPKGVVHTVGGYMLYVATTFKYVFDFHAEDVFWCTAD |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ACSS2 acyl-CoA synthetase short-chain family member 2 [ Homo sapiens ] |
Official Symbol | ACSS2 |
Synonyms | ACSS2; acyl-CoA synthetase short-chain family member 2; ACAS2, acetyl Coenzyme A synthetase 2 (ADP forming); acetyl-coenzyme A synthetase, cytoplasmic; AceCS; ACS; ACSA; dJ1161H23.1; acetate thiokinase; acetate-CoA ligase; acyl-activating enzyme; cytoplasmic acetyl-coenzyme A synthetase; acetyl-Coenzyme A synthetase 2 (ADP forming); ACAS2; ACECS; DKFZp762G026; |
Gene ID | 55902 |
mRNA Refseq | NM_001076552 |
Protein Refseq | NP_001070020 |
MIM | 605832 |
UniProt ID | Q9NR19 |
◆ Recombinant Proteins | ||
ACSS2-264H | Recombinant Human ACSS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Acss2-1513M | Recombinant Mouse Acss2 Protein, Myc/DDK-tagged | +Inquiry |
ACSS2-4019H | Recombinant Human ACSS2 protein, His-tagged | +Inquiry |
ACSS2-814HF | Recombinant Full Length Human ACSS2 Protein, GST-tagged | +Inquiry |
ACSS2-1107M | Recombinant Mouse ACSS2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACSS2-9068HCL | Recombinant Human ACSS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACSS2 Products
Required fields are marked with *
My Review for All ACSS2 Products
Required fields are marked with *