Recombinant Human ACSS2 protein, His-tagged
| Cat.No. : | ACSS2-4019H |
| Product Overview : | Recombinant Human ACSS2 protein(18-191 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 09, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 18-191 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | ALHSIVFAGFSSESLCERILDSSCSLLITTDAFYRGEKLVNLKELADEALQKCQEKGFPVRCCIVVKHLGRAELGMGDSTSQSPPIKRSCPDVQISWNQGIDLWWHELMQEAGDECEPEWCDAEDPLFILYTSGSTGKPKGVVHTVGGYMLYVATTFKYVFDFHAEDVFWCTAD |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ACSS2 acyl-CoA synthetase short-chain family member 2 [ Homo sapiens ] |
| Official Symbol | ACSS2 |
| Synonyms | ACSS2; acyl-CoA synthetase short-chain family member 2; ACAS2, acetyl Coenzyme A synthetase 2 (ADP forming); acetyl-coenzyme A synthetase, cytoplasmic; AceCS; ACS; ACSA; dJ1161H23.1; acetate thiokinase; acetate-CoA ligase; acyl-activating enzyme; cytoplasmic acetyl-coenzyme A synthetase; acetyl-Coenzyme A synthetase 2 (ADP forming); ACAS2; ACECS; DKFZp762G026; |
| Gene ID | 55902 |
| mRNA Refseq | NM_001076552 |
| Protein Refseq | NP_001070020 |
| MIM | 605832 |
| UniProt ID | Q9NR19 |
| ◆ Recombinant Proteins | ||
| ACSS2-1236M | Recombinant Mouse ACSS2 Protein | +Inquiry |
| ACSS2-67H | Recombinant Human ACSS2 Protein, His-tagged | +Inquiry |
| ACSS2-47R | Recombinant Rhesus Macaque ACSS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ACSS2-4019H | Recombinant Human ACSS2 protein, His-tagged | +Inquiry |
| ACSS2-279M | Recombinant Mouse ACSS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACSS2-9068HCL | Recombinant Human ACSS2 293 Cell Lysate | +Inquiry |
| ACSS2-473HKCL | Human ACSS2 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACSS2 Products
Required fields are marked with *
My Review for All ACSS2 Products
Required fields are marked with *
