Recombinant Human ACTL8 Protein, GST-tagged
Cat.No. : | ACTL8-227H |
Product Overview : | Human ACTL8 full-length ORF ( NP_110439.1, 1 a.a. - 366 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ACTL8 (Actin Like 8) is a Protein Coding gene. An important paralog of this gene is ACTR2. |
Molecular Mass : | 67.8 kDa |
AA Sequence : | MASRTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPDTFSYPIERGRILNWEGVQYLWSFVLENHRREQEVPPVIITETPLREPADRKKMLEILFELLHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEFAGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDESNTYQLPDGSRVELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESVESCEISLRPLLVSHVMACGGNTLYPGFTKRLFRELMGDHVSSTKATVWEGSNRNFSVWLGASVVAHLSTYQSEWMSREEYGEHMRM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ACTL8 actin-like 8 [ Homo sapiens ] |
Official Symbol | ACTL8 |
Synonyms | ACTL8; actin-like 8; actin-like protein 8; cancer/testis antigen 57; CT57; actin like protein; |
Gene ID | 81569 |
mRNA Refseq | NM_030812 |
Protein Refseq | NP_110439 |
UniProt ID | Q9H568 |
◆ Recombinant Proteins | ||
ACTL8-2777H | Recombinant Human ACTL8 Protein (1-366 aa), His-Myc-tagged | +Inquiry |
ACTL8-4920H | Recombinant Human ACTL8 protein, His&Myc-tagged | +Inquiry |
ACTL8-2660H | Recombinant Human ACTL8 Protein (1-366 aa), His-tagged | +Inquiry |
ACTL8-850HF | Recombinant Full Length Human ACTL8 Protein, GST-tagged | +Inquiry |
ACTL8-4921H | Recombinant Human ACTL8 protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTL8-9057HCL | Recombinant Human ACTL8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACTL8 Products
Required fields are marked with *
My Review for All ACTL8 Products
Required fields are marked with *
0
Inquiry Basket