Recombinant Human ACTL8 Protein, GST-tagged
| Cat.No. : | ACTL8-227H |
| Product Overview : | Human ACTL8 full-length ORF ( NP_110439.1, 1 a.a. - 366 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ACTL8 (Actin Like 8) is a Protein Coding gene. An important paralog of this gene is ACTR2. |
| Molecular Mass : | 67.8 kDa |
| AA Sequence : | MASRTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPDTFSYPIERGRILNWEGVQYLWSFVLENHRREQEVPPVIITETPLREPADRKKMLEILFELLHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEFAGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDESNTYQLPDGSRVELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESVESCEISLRPLLVSHVMACGGNTLYPGFTKRLFRELMGDHVSSTKATVWEGSNRNFSVWLGASVVAHLSTYQSEWMSREEYGEHMRM |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ACTL8 actin-like 8 [ Homo sapiens ] |
| Official Symbol | ACTL8 |
| Synonyms | ACTL8; actin-like 8; actin-like protein 8; cancer/testis antigen 57; CT57; actin like protein; |
| Gene ID | 81569 |
| mRNA Refseq | NM_030812 |
| Protein Refseq | NP_110439 |
| UniProt ID | Q9H568 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACTL8 Products
Required fields are marked with *
My Review for All ACTL8 Products
Required fields are marked with *




