Recombinant Human ACTL8 Protein, GST-tagged

Cat.No. : ACTL8-227H
Product Overview : Human ACTL8 full-length ORF ( NP_110439.1, 1 a.a. - 366 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ACTL8 (Actin Like 8) is a Protein Coding gene. An important paralog of this gene is ACTR2.
Molecular Mass : 67.8 kDa
AA Sequence : MASRTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPDTFSYPIERGRILNWEGVQYLWSFVLENHRREQEVPPVIITETPLREPADRKKMLEILFELLHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEFAGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDESNTYQLPDGSRVELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESVESCEISLRPLLVSHVMACGGNTLYPGFTKRLFRELMGDHVSSTKATVWEGSNRNFSVWLGASVVAHLSTYQSEWMSREEYGEHMRM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ACTL8 actin-like 8 [ Homo sapiens ]
Official Symbol ACTL8
Synonyms ACTL8; actin-like 8; actin-like protein 8; cancer/testis antigen 57; CT57; actin like protein;
Gene ID 81569
mRNA Refseq NM_030812
Protein Refseq NP_110439
UniProt ID Q9H568

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACTL8 Products

Required fields are marked with *

My Review for All ACTL8 Products

Required fields are marked with *

0
cart-icon
0
compare icon