Recombinant Human ACTR1A, His-tagged

Cat.No. : ACTR1A-26591TH
Product Overview : Recombinant fragment, corresponding to amino acids 97-376 of Human ACTR1A with an N terminal His tag. Predicted MWt: 33 kDa
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 97-376 a.a.
Description : This gene encodes a 42.6 kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 8-13 copies per dynactin molecule, and is the most abundant molecule in the dynactin complex. It is an actin-related protein, and is approximately 60% identical at the amino acid level to conventional actin.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 125 μl distilled water.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPA LFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGF AMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFE IVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDL RRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKI RISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEED GARSIHRKTF
Gene Name ACTR1A ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) [ Homo sapiens ]
Official Symbol ACTR1A
Synonyms ACTR1A; ARP1 actin-related protein 1 homolog A, centractin alpha (yeast); ARP1 (actin related protein 1, yeast) homolog A (centractin alpha); alpha-centractin; ARP1;
Gene ID 10121
mRNA Refseq NM_005736
Protein Refseq NP_005727
MIM 605143
Uniprot ID P61163
Chromosome Location 10q24
Pathway Cell Cycle, Mitotic, organism-specific biosystem; Centrosome maturation, organism-specific biosystem; G2/M Transition, organism-specific biosystem; Loss of Nlp from mitotic centrosomes, organism-specific biosystem; Loss of proteins required for interphase microtubule organization??from the centrosome, organism-specific biosystem;
Function ATP binding; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACTR1A Products

Required fields are marked with *

My Review for All ACTR1A Products

Required fields are marked with *

0
cart-icon