Recombinant Human ACTR1A, His-tagged
Cat.No. : | ACTR1A-26591TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 97-376 of Human ACTR1A with an N terminal His tag. Predicted MWt: 33 kDa |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 97-376 a.a. |
Description : | This gene encodes a 42.6 kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 8-13 copies per dynactin molecule, and is the most abundant molecule in the dynactin complex. It is an actin-related protein, and is approximately 60% identical at the amino acid level to conventional actin. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 125 μl distilled water. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPA LFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGF AMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFE IVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDL RRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKI RISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEED GARSIHRKTF |
Gene Name | ACTR1A ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) [ Homo sapiens ] |
Official Symbol | ACTR1A |
Synonyms | ACTR1A; ARP1 actin-related protein 1 homolog A, centractin alpha (yeast); ARP1 (actin related protein 1, yeast) homolog A (centractin alpha); alpha-centractin; ARP1; |
Gene ID | 10121 |
mRNA Refseq | NM_005736 |
Protein Refseq | NP_005727 |
MIM | 605143 |
Uniprot ID | P61163 |
Chromosome Location | 10q24 |
Pathway | Cell Cycle, Mitotic, organism-specific biosystem; Centrosome maturation, organism-specific biosystem; G2/M Transition, organism-specific biosystem; Loss of Nlp from mitotic centrosomes, organism-specific biosystem; Loss of proteins required for interphase microtubule organization??from the centrosome, organism-specific biosystem; |
Function | ATP binding; nucleotide binding; |
◆ Recombinant Proteins | ||
ACTR1A-232H | Recombinant Human ACTR1A Protein, GST-tagged | +Inquiry |
ACTR1A-1806C | Recombinant Chicken ACTR1A | +Inquiry |
ACTR1A-1252M | Recombinant Mouse ACTR1A Protein | +Inquiry |
ACTR1A-151H | Recombinant Human ACTR1A Protein, His-tagged | +Inquiry |
ACTR1A-21C | Recombinant Cynomolgus Monkey ACTR1A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTR1A-9053HCL | Recombinant Human ACTR1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACTR1A Products
Required fields are marked with *
My Review for All ACTR1A Products
Required fields are marked with *