Recombinant Human ACTRT1 Protein, GST-tagged
| Cat.No. : | ACTRT1-243H |
| Product Overview : | Human ACTRT1 partial ORF ( NP_612146.1, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a protein related to the cytoskeletal protein beta-actin. This protein is a major component of the calyx in the perinuclear theca of mammalian sperm heads, and it therefore likely functions in spermatid formation. This gene is intronless and is similar to a related gene located on chromosome 1. A related pseudogene has also been identified approximately 75 kb downstream of this gene on chromosome X. [provided by RefSeq, May 2010] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | MFNPHALDVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQKYFVGQEALYKYEALHLHYPIERGLVTGWDDMEKLWKHLFERELGVK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ACTRT1 actin-related protein T1 [ Homo sapiens ] |
| Official Symbol | ACTRT1 |
| Synonyms | ACTRT1; actin-related protein T1; AIP1; ARIP1; Arp T1; KIAA0705; ARPT1; HSD27; MGC26590; |
| Gene ID | 139741 |
| mRNA Refseq | NM_138289 |
| Protein Refseq | NP_612146 |
| MIM | 300487 |
| UniProt ID | Q8TDG2 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACTRT1 Products
Required fields are marked with *
My Review for All ACTRT1 Products
Required fields are marked with *
