Recombinant Human ACTRT1 Protein, GST-tagged
Cat.No. : | ACTRT1-243H |
Product Overview : | Human ACTRT1 partial ORF ( NP_612146.1, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein related to the cytoskeletal protein beta-actin. This protein is a major component of the calyx in the perinuclear theca of mammalian sperm heads, and it therefore likely functions in spermatid formation. This gene is intronless and is similar to a related gene located on chromosome 1. A related pseudogene has also been identified approximately 75 kb downstream of this gene on chromosome X. [provided by RefSeq, May 2010] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | MFNPHALDVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQKYFVGQEALYKYEALHLHYPIERGLVTGWDDMEKLWKHLFERELGVK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ACTRT1 actin-related protein T1 [ Homo sapiens ] |
Official Symbol | ACTRT1 |
Synonyms | ACTRT1; actin-related protein T1; AIP1; ARIP1; Arp T1; KIAA0705; ARPT1; HSD27; MGC26590; |
Gene ID | 139741 |
mRNA Refseq | NM_138289 |
Protein Refseq | NP_612146 |
MIM | 300487 |
UniProt ID | Q8TDG2 |
◆ Recombinant Proteins | ||
ACTRT1-861HF | Recombinant Full Length Human ACTRT1 Protein, GST-tagged | +Inquiry |
ACTRT1-147R | Recombinant Rat ACTRT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACTRT1-22C | Recombinant Cynomolgus Monkey ACTRT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACTRT1-272C | Recombinant Cynomolgus ACTRT1 Protein, His-tagged | +Inquiry |
ACTRT1-242H | Recombinant Human ACTRT1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTRT1-9045HCL | Recombinant Human ACTRT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACTRT1 Products
Required fields are marked with *
My Review for All ACTRT1 Products
Required fields are marked with *
0
Inquiry Basket