Recombinant Human ACVR1B protein, GST-tagged
Cat.No. : | ACVR1B-1532H |
Product Overview : | Recombinant Human ACVR1B protein(211-448 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 211-448 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | EIIGKGRFGEVWRGRWRGGDVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTIEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCAIADLGLAVRHDAVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWEIARRCNSGGVHEEYQLPYYDLVPSDPSIEEMRKVVC |
Gene Name | ACVR1B activin A receptor, type IB [ Homo sapiens ] |
Official Symbol | ACVR1B |
Synonyms | ACVR1B; activin A receptor, type IB; ACVRLK4; activin receptor type-1B; ActRIB; ALK4; SKR2; activin receptor-like kinase 4; activin A receptor, type II-like kinase 4; serine/threonine-protein kinase receptor R2; ACTRIB; |
Gene ID | 91 |
mRNA Refseq | NM_004302 |
Protein Refseq | NP_004293 |
MIM | 601300 |
UniProt ID | P36896 |
◆ Recombinant Proteins | ||
ACVR1B-8815C | Recombinant Cynomolgus ACVR1B, Fc tagged | +Inquiry |
ACVR1B-0223H | Recombinant Human ACVR1B Protein (Ser24-Glu126), His-tagged | +Inquiry |
ACVR1B-250H | Recombinant Human ACVR1B Protein, GST-tagged | +Inquiry |
ACVR1B-1288H | Recombinant Human ACVR1B Protein (N150-I505), Tag Free | +Inquiry |
ACVR1B-2179R | Active Recombinant Rat ACVR1B protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACVR1B-1206RCL | Recombinant Rat ACVR1B cell lysate | +Inquiry |
ACVR1B-2130HCL | Recombinant Human ACVR1B cell lysate | +Inquiry |
ACVR1B-1356CCL | Recombinant Cynomolgus ACVR1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACVR1B Products
Required fields are marked with *
My Review for All ACVR1B Products
Required fields are marked with *