Recombinant Human ACVR1B Protein, His-tagged

Cat.No. : ACVR1B-169H
Product Overview : Recombinant Human Activin Receptor Type-1B is produced by our Mammalian expression system and the target gene encoding Ser24-Glu126 is expressed with a 6His tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : His
Protein Length : Ser24-Glu126
Description : Activin Receptor Type-1B (ACVR1B) is a single-pass type I membrane protein that belongs to the protein kinase superfamily. ACVR1B contains one GS domain and one protein kinase domain and is expressed in many tissues, most strongly in kidney, pancreas, brain, lung, and liver. ACVR1B acts as a transducer of activin or activin like ligands signals. Activin binds to either ACVR2A or ACVR2B and then forms a complex with ACVR1B, ACVR2A or ACVR2B activating ACVR1B through phosphorylation of its regulatory GS domain. They go on to recruit the R-SMADs, SMAD2 and SMAD3. ACVR1B also transducers signals of nodal, GDF-1, and Vg1. Mutations in ACVR1B are associated with pituitary tumors.
Form : Lyophilized from a 0.2 um filtered solution of 20mM PB,150mM NaCl, pH7.4.
AA Sequence : SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRN THCCYTDYCNRIDLR VPSGHLKEPEHPSMWGPVEVDHHHHHH
Endotoxin : Less than 0.1 ng/ug (1 EU/ug).
Purity : >95%
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100μg/ml.
Dissolve the lyophilized protein in distilled water.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Quality Statement : Purity: Greater than 95% as determined by reducing SDS-PAGE.
Shipping : The product is shipped at ambient temperature.
Upon receipt, store it immediately at the temperature listed below.
Gene Name ACVR1B activin A receptor type 1B [ Homo sapiens (human) ]
Official Symbol ACVR1B
Synonyms Activin Receptor Type-1B; Activin Receptor Type IB; ACTR-IB; Activin Receptor-Like Kinase 4; ALK4; Serine/Threonine-Protein Kinase Receptor R2; SKR2; ACVRLK4; ALK4
Gene ID 91
mRNA Refseq NM_001412774.1
Protein Refseq NP_001399703.1
MIM 601300
UniProt ID P36896

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACVR1B Products

Required fields are marked with *

My Review for All ACVR1B Products

Required fields are marked with *

0
cart-icon
0
compare icon