Recombinant Human ACVRL1 protein, His-tagged

Cat.No. : ACVRL1-4647Y
Product Overview : Recombinant Human ACVRL1 protein(P37023)(22-118 aa), fused with N-terminal His tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 22-118 aa
Form : For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
Molecular Mass : 12.2 kDa
AASequence : DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQ
Purity : Greater than 95% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.
Gene Name ACVRL1 activin A receptor type II-like 1 [ Homo sapiens ]
Official Symbol ACVRL1
Synonyms ACVRL1; activin A receptor type II-like 1; ACVRLK1, ORW2; serine/threonine-protein kinase receptor R3; ALK1; HHT; HHT2; activin receptor-like kinase 1; TGF-B superfamily receptor type I; activin A receptor, type II-like kinase 1; ORW2; SKR3; ALK-1; TSR-I; ACVRLK1;
Gene ID 94
mRNA Refseq NM_000020
Protein Refseq NP_000011
MIM 601284
UniProt ID P37023

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACVRL1 Products

Required fields are marked with *

My Review for All ACVRL1 Products

Required fields are marked with *

0
cart-icon