Recombinant Human ACVRL1 protein, His-tagged
Cat.No. : | ACVRL1-4657H |
Product Overview : | Recombinant Human ACVRL1 protein(P37023)(22-118 aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 22-118 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 12.2 kDa |
AASequence : | DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQ |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | ACVRL1 activin A receptor type II-like 1 [ Homo sapiens ] |
Official Symbol | ACVRL1 |
Synonyms | ACVRL1; activin A receptor type II-like 1; ACVRLK1, ORW2; serine/threonine-protein kinase receptor R3; ALK1; HHT; HHT2; activin receptor-like kinase 1; TGF-B superfamily receptor type I; activin A receptor, type II-like kinase 1; ORW2; SKR3; ALK-1; TSR-I; ACVRLK1; |
Gene ID | 94 |
mRNA Refseq | NM_000020 |
Protein Refseq | NP_000011 |
MIM | 601284 |
UniProt ID | P37023 |
◆ Recombinant Proteins | ||
ACVRL1-2353C | Recombinant Cynomolgus ACVRL1 protein(Met1-Gln118), hFc-tagged | +Inquiry |
ACVRL1-318C | Active Recombinant Canine ACVRL1 protein, hFc-tagged | +Inquiry |
Acvrl1-7565M | Recombinant Mouse Acvrl1 protein, hFc-tagged, For Organoid Culture | +Inquiry |
ACVRL1-26593TH | Recombinant Human ACVRL1 | +Inquiry |
ACVRL1-152R | Recombinant Rat ACVRL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACVRL1-994CCL | Recombinant Canine ACVRL1 cell lysate | +Inquiry |
ACVRL1-3093MCL | Recombinant Mouse ACVRL1 cell lysate | +Inquiry |
ACVRL1-2629HCL | Recombinant Human ACVRL1 cell lysate | +Inquiry |
ACVRL1-3001RCL | Recombinant Rat ACVRL1 cell lysate | +Inquiry |
ACVRL1-1191CCL | Recombinant Cynomolgus ACVRL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACVRL1 Products
Required fields are marked with *
My Review for All ACVRL1 Products
Required fields are marked with *