Recombinant Human ACYP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | ACYP1-2929H |
| Product Overview : | ACYP1 MS Standard C13 and N15-labeled recombinant protein (NP_001098) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene is a member of the acylphosphatase family. The encoded protein is a small cytosolic enzyme that catalyzes the hydrolysis of the carboxyl-phosphate bond of acylphosphates. Two isoenzymes have been isolated and described based on their tissue localization: erythrocyte (common) type acylphosphatase encoded by this gene, and muscle type acylphosphatase. Alternative splicing results in multiple transcript variants. |
| Molecular Mass : | 11.3 kDa |
| AA Sequence : | MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | ACYP1 acylphosphatase 1 [ Homo sapiens (human) ] |
| Official Symbol | ACYP1 |
| Synonyms | ACYP1; acylphosphatase 1, erythrocyte (common) type; acylphosphatase-1; acylphosphate phosphohydrolase 1; acylphosphatase, erythrocyte isozyme; acylphosphatase, organ-common type isozyme; ACYPE; |
| Gene ID | 97 |
| mRNA Refseq | NM_001107 |
| Protein Refseq | NP_001098 |
| MIM | 600875 |
| UniProt ID | P07311 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACYP1 Products
Required fields are marked with *
My Review for All ACYP1 Products
Required fields are marked with *
