Recombinant Human ACYP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ACYP1-2929H |
Product Overview : | ACYP1 MS Standard C13 and N15-labeled recombinant protein (NP_001098) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene is a member of the acylphosphatase family. The encoded protein is a small cytosolic enzyme that catalyzes the hydrolysis of the carboxyl-phosphate bond of acylphosphates. Two isoenzymes have been isolated and described based on their tissue localization: erythrocyte (common) type acylphosphatase encoded by this gene, and muscle type acylphosphatase. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 11.3 kDa |
AA Sequence : | MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ACYP1 acylphosphatase 1 [ Homo sapiens (human) ] |
Official Symbol | ACYP1 |
Synonyms | ACYP1; acylphosphatase 1, erythrocyte (common) type; acylphosphatase-1; acylphosphate phosphohydrolase 1; acylphosphatase, erythrocyte isozyme; acylphosphatase, organ-common type isozyme; ACYPE; |
Gene ID | 97 |
mRNA Refseq | NM_001107 |
Protein Refseq | NP_001098 |
MIM | 600875 |
UniProt ID | P07311 |
◆ Recombinant Proteins | ||
ACYP1-16H | Recombinant Human ACYP1 protein | +Inquiry |
ACYP1-3355H | Recombinant Human ACYP1 protein, His-tagged | +Inquiry |
ACYP1-264H | Recombinant Human ACYP1 Protein, GST-tagged | +Inquiry |
ACYP1-2929H | Recombinant Human ACYP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Acyp1-1525M | Recombinant Mouse Acyp1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACYP1-9042HCL | Recombinant Human ACYP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACYP1 Products
Required fields are marked with *
My Review for All ACYP1 Products
Required fields are marked with *
0
Inquiry Basket