Recombinant Human ADAM20 Protein, GST-tagged

• Cat.No.: ADAM20-281H
• Product Overview: Human ADAM20 partial ORF ( NP_003805, 268 a.a. - 358 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The expression of this gene is testis-specific. [provided by RefSeq, Jul 2008]
• Molecular Mass: 35.75 kDa
• AA Sequence: IRYLFSQSNATTVQHEVFNVVNIVDSFYHPLEVDVILTGIDIWTASNPLPTSGDLDNVLEDFSIWKNYNLNNRLQHDVAHLFIKDTQGMKL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ADAM20 ADAM metallopeptidase domain 20 [ Homo sapiens ]
• Official Symbol: ADAM20
• Synonyms: ADAM20; ADAM metallopeptidase domain 20; a disintegrin and metalloproteinase domain 20; disintegrin and metalloproteinase domain-containing protein 20; ADAM 20
• Gene ID: 8748
• mRNA Refseq: NM_003814
• Protein Refseq: NP_003805
• MIM: 603712
• UniProt ID: O43506