Recombinant Human ADAM20 Protein, GST-tagged
| Cat.No. : | ADAM20-281H |
| Product Overview : | Human ADAM20 partial ORF ( NP_003805, 268 a.a. - 358 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The expression of this gene is testis-specific. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 35.75 kDa |
| AA Sequence : | IRYLFSQSNATTVQHEVFNVVNIVDSFYHPLEVDVILTGIDIWTASNPLPTSGDLDNVLEDFSIWKNYNLNNRLQHDVAHLFIKDTQGMKL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ADAM20 ADAM metallopeptidase domain 20 [ Homo sapiens ] |
| Official Symbol | ADAM20 |
| Synonyms | ADAM20; ADAM metallopeptidase domain 20; a disintegrin and metalloproteinase domain 20; disintegrin and metalloproteinase domain-containing protein 20; ADAM 20; |
| Gene ID | 8748 |
| mRNA Refseq | NM_003814 |
| Protein Refseq | NP_003805 |
| MIM | 603712 |
| UniProt ID | O43506 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAM20 Products
Required fields are marked with *
My Review for All ADAM20 Products
Required fields are marked with *
