Recombinant Human ADAMTS15 Protein, GST-tagged

Cat.No. : ADAMTS15-300H
Product Overview : Human ADAMTS15 partial ORF ( NP_620686, 863 a.a. - 950 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The encoded preproprotein is proteolytically processed to generate the mature enzyme, which may play a role in versican processing during skeletal muscle development. This gene may function as a tumor suppressor in colorectal and breast cancers. [provided by RefSeq, May 2016]
Molecular Mass : 35.42 kDa
AA Sequence : AVDCRGSAGQRTVPACDAAHRPVETQACGEPCPTWELSAWSPCSKSCGRGFQRRSLKCVGHGGRLLARDQCNLHRKPQELDFCVLRPC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ADAMTS15 ADAM metallopeptidase with thrombospondin type 1 motif, 15 [ Homo sapiens ]
Official Symbol ADAMTS15
Synonyms ADAMTS15; ADAM metallopeptidase with thrombospondin type 1 motif, 15; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 15; A disintegrin and metalloproteinase with thrombospondin motifs 15; ADAM-TS15; ADAMTS-15; ADAM-TS 15; metalloprotease disintegrin 15 with thrombospondin domains; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 15, preproprotein; MGC126403;
Gene ID 170689
mRNA Refseq NM_139055
Protein Refseq NP_620686
MIM 607509
UniProt ID Q8TE58

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADAMTS15 Products

Required fields are marked with *

My Review for All ADAMTS15 Products

Required fields are marked with *

0
cart-icon