Recombinant Human ADAMTSL4 protein, GST-tagged

Cat.No. : ADAMTSL4-33H
Product Overview : Recombinant Human ADAMTSL4(1 a.a. - 424 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-424 a.a.
Description : This gene is a member of ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs)-like gene family and encodes a protein with seven thrombospondin type 1 repeats. The thrombospondin type 1 repeat domain is found in many proteins with diverse biological functions including cellular adhesion, angiogenesis, and patterning of the developing nervous system. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 71.43 kDa
AA Sequence : MPAPPHPRTPLGSPAAYWKRVGHSACSASCGKGVWRPIFLCISRESGEELDERSCAAGARPPASPEPCHGTPCPP YWEAGEWTSCSRSCGPGTQHRQLQCRQEFGGGGSSVPPERCGHLPRPNITQSCQLRLCGHWEVGSPWSQCSVRCG RGQRSRQVRCVGNNGDEVSEQECASGPPQPPSREACDMGPCTTAWFHSDWSSKCSAECGTGIQRRSVVCLGSGAA LGPGQGEAGAGTGQSCPTGSRPPDMRACSLGPCERTWRWYTGPWGECSSECGSGTQRRDIICVSKLGTEFNVTSP SNCSHLPRPPALQPCQGQACQDRWFSTPWSPCSRSCQGGTQTREVQCLSTNQTLSTRCPPQLRPSRKRPCNSQPC SQRPDDQCKDSSPHCPLVVQARLCVYPYYTATCCRSCAHVLERSPQDPS
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name ADAMTSL4 ADAMTS-like 4 [ Homo sapiens ]
Official Symbol ADAMTSL4
Synonyms ADAMTSL4; ADAMTS-like 4; thrombospondin repeat containing 1 , TSRC1; ADAMTS-like protein 4; DKFZP434K1772; ADAMTSL-4; thrombospondin repeat containing 1; thrombospondin repeat-containing protein 1; TSRC1;
Gene ID 54507
mRNA Refseq NM_019032
Protein Refseq NP_061905
MIM 610113
UniProt ID Q6UY14
Chromosome Location 1q21.2
Function metalloendopeptidase activity; peptidase activity; protease binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADAMTSL4 Products

Required fields are marked with *

My Review for All ADAMTSL4 Products

Required fields are marked with *

0
cart-icon