Recombinant Human ADAMTSL4 protein, GST-tagged
| Cat.No. : | ADAMTSL4-33H |
| Product Overview : | Recombinant Human ADAMTSL4(1 a.a. - 424 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-424 a.a. |
| Description : | This gene is a member of ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs)-like gene family and encodes a protein with seven thrombospondin type 1 repeats. The thrombospondin type 1 repeat domain is found in many proteins with diverse biological functions including cellular adhesion, angiogenesis, and patterning of the developing nervous system. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 71.43 kDa |
| AA Sequence : | MPAPPHPRTPLGSPAAYWKRVGHSACSASCGKGVWRPIFLCISRESGEELDERSCAAGARPPASPEPCHGTPCPP YWEAGEWTSCSRSCGPGTQHRQLQCRQEFGGGGSSVPPERCGHLPRPNITQSCQLRLCGHWEVGSPWSQCSVRCG RGQRSRQVRCVGNNGDEVSEQECASGPPQPPSREACDMGPCTTAWFHSDWSSKCSAECGTGIQRRSVVCLGSGAA LGPGQGEAGAGTGQSCPTGSRPPDMRACSLGPCERTWRWYTGPWGECSSECGSGTQRRDIICVSKLGTEFNVTSP SNCSHLPRPPALQPCQGQACQDRWFSTPWSPCSRSCQGGTQTREVQCLSTNQTLSTRCPPQLRPSRKRPCNSQPC SQRPDDQCKDSSPHCPLVVQARLCVYPYYTATCCRSCAHVLERSPQDPS |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | ADAMTSL4 ADAMTS-like 4 [ Homo sapiens ] |
| Official Symbol | ADAMTSL4 |
| Synonyms | ADAMTSL4; ADAMTS-like 4; thrombospondin repeat containing 1 , TSRC1; ADAMTS-like protein 4; DKFZP434K1772; ADAMTSL-4; thrombospondin repeat containing 1; thrombospondin repeat-containing protein 1; TSRC1; |
| Gene ID | 54507 |
| mRNA Refseq | NM_019032 |
| Protein Refseq | NP_061905 |
| MIM | 610113 |
| UniProt ID | Q6UY14 |
| Chromosome Location | 1q21.2 |
| Function | metalloendopeptidase activity; peptidase activity; protease binding; protein binding; |
| ◆ Recombinant Proteins | ||
| ADAMTSL4-328M | Recombinant Mouse ADAMTSL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ADAMTSL4-32H | Recombinant Human ADAMTSL4 protein, GST-tagged | +Inquiry |
| ADAMTSL4-508R | Recombinant Rat ADAMTSL4 Protein | +Inquiry |
| ADAMTSL4-33H | Recombinant Human ADAMTSL4 protein, GST-tagged | +Inquiry |
| ADAMTSL4-1327M | Recombinant Mouse ADAMTSL4 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADAMTSL4-27HCL | Recombinant Human ADAMTSL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAMTSL4 Products
Required fields are marked with *
My Review for All ADAMTSL4 Products
Required fields are marked with *
