Recombinant Human ADAR protein, His-tagged
Cat.No. : | ADAR-2894H |
Product Overview : | Recombinant Human ADAR protein(P55265)(1-176aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-176aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 23.8 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MNPRQGYSLSGYYTHPFQGYEHRQLRYQQPGPGSSPSSFLLKQIEFLKGQLPEAPVIGKQTPSLPPSLPGLRPRFPVLLASSTRGRQVDIRGVPRGVHLRSQGLQRGFQHPSPRGRSLPQRGVDCLSSHFQELSIYQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVL |
Gene Name | ADAR adenosine deaminase, RNA-specific [ Homo sapiens ] |
Official Symbol | ADAR |
Synonyms | ADAR; adenosine deaminase, RNA-specific; G1P1, IFI4, interferon induced protein 4; double-stranded RNA-specific adenosine deaminase; ADAR1; dsRNA adenosine deaminase; interferon-induced protein 4; interferon-inducible protein 4; adenosine deaminase acting on RNA 1-A; 136 kDa double-stranded RNA-binding protein; DSH; G1P1; IFI4; P136; DRADA; DSRAD; IFI-4; K88DSRBP; |
Gene ID | 103 |
mRNA Refseq | NM_001025107 |
Protein Refseq | NP_001020278 |
MIM | 146920 |
UniProt ID | P55265 |
◆ Recombinant Proteins | ||
ADAR-528H | Recombinant Human ADAR protein, MYC/DDK-tagged | +Inquiry |
ADAR-2484H | Recombinant Human ADAR protein, His-SUMO-tagged | +Inquiry |
ADAR-20H | Recombinant Human ADAR Protein, His tagged | +Inquiry |
ADAR-2486H | Recombinant Human ADAR protein, His-tagged | +Inquiry |
ADAR-6475H | Recombinant Human ADAR protein, hFc-tagged | +Inquiry |
◆ Native Proteins | ||
ADAR-12HFL | Active Recombinant Full Length Human ADAR Protein, Flag tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAR-9026HCL | Recombinant Human ADAR 293 Cell Lysate | +Inquiry |
ADAR-9025HCL | Recombinant Human ADAR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAR Products
Required fields are marked with *
My Review for All ADAR Products
Required fields are marked with *
0
Inquiry Basket