Recombinant Human ADARB2 protein, GST-tagged

• Cat.No.: ADARB2-301224H
• Product Overview: Recombinant Human ADARB2 (333-404 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Gln333-Ala404
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: QAALQELFDIQMPGHAPGRARRTPMPQEFADSISQLVTQKFREVTTDLTPMHARHKALAGIVMTKGLDARQA
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ADARB2 adenosine deaminase, RNA-specific, B2 [ Homo sapiens ]
• Official Symbol: ADARB2
• Synonyms: ADARB2; adenosine deaminase, RNA-specific, B2; adenosine deaminase, RNA specific, B2 (RED2 homolog rat); double-stranded RNA-specific editase B2; ADAR3; hRED2; RED2; RED2 homolog (rat); RED2 homolog; homolog of rat BLUE; RNA-editing enzyme 2; RNA-editing deaminase 2; dsRNA adenosine deaminase B2; RNA-dependent adenosine deaminase 3; adenosine deaminase, RNA-specific, B2 (RED1 homolog rat); adenosine deaminase, RNA-specific, B2 (RED2 homolog rat); FLJ25034; FLJ36975; FLJ41340
• Gene ID: 105
• mRNA Refseq: NM_018702
• Protein Refseq: NP_061172
• MIM: 602065
• UniProt ID: Q9NS39