Recombinant Human ADAT2 protein, GST-tagged
Cat.No. : | ADAT2-3737H |
Product Overview : | Recombinant Human ADAT2 protein(33-193 aa), fused to GST tag, was expressed in E. coli. |
Availability | June 11, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 33-193 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | HMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRQSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ADAT2 adenosine deaminase, tRNA-specific 2 [ Homo sapiens ] |
Official Symbol | ADAT2 |
Synonyms | ADAT2; adenosine deaminase, tRNA-specific 2; adenosine deaminase, tRNA specific 2, TAD2 homolog (S. cerevisiae) , DEADC1, deaminase domain containing 1; tRNA-specific adenosine deaminase 2; dJ20N2.1; TAD2; tRNA specific adenosine deaminase 2 homolog (S. cerevisiae); deaminase domain containing 1; deaminase domain-containing protein 1; tRNA-specific adenosine deaminase 2 homolog; adenosine deaminase, tRNA-specific 2, TAD2 homolog; tRNA-specific adenosine-34 deaminase subunit ADAT2; DEADC1; dJ20N2; |
Gene ID | 134637 |
mRNA Refseq | NM_182503 |
Protein Refseq | NP_872309 |
UniProt ID | Q7Z6V5 |
◆ Recombinant Proteins | ||
ADAT2-2409HF | Recombinant Full Length Human ADAT2 Protein, GST-tagged | +Inquiry |
ADAT2-331M | Recombinant Mouse ADAT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADAT2-1142H | Recombinant Human ADAT2 Protein, MYC/DDK-tagged | +Inquiry |
ADAT2-790H | Recombinant Human ADAT2, His-tagged | +Inquiry |
Adat2-1536M | Recombinant Mouse Adat2 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAT2 Products
Required fields are marked with *
My Review for All ADAT2 Products
Required fields are marked with *
0
Inquiry Basket