Recombinant Human ADAT2 protein, GST-tagged

Cat.No. : ADAT2-3737H
Product Overview : Recombinant Human ADAT2 protein(33-193 aa), fused to GST tag, was expressed in E. coli.
Availability June 11, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 33-193 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : HMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRQSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name ADAT2 adenosine deaminase, tRNA-specific 2 [ Homo sapiens ]
Official Symbol ADAT2
Synonyms ADAT2; adenosine deaminase, tRNA-specific 2; adenosine deaminase, tRNA specific 2, TAD2 homolog (S. cerevisiae) , DEADC1, deaminase domain containing 1; tRNA-specific adenosine deaminase 2; dJ20N2.1; TAD2; tRNA specific adenosine deaminase 2 homolog (S. cerevisiae); deaminase domain containing 1; deaminase domain-containing protein 1; tRNA-specific adenosine deaminase 2 homolog; adenosine deaminase, tRNA-specific 2, TAD2 homolog; tRNA-specific adenosine-34 deaminase subunit ADAT2; DEADC1; dJ20N2;
Gene ID 134637
mRNA Refseq NM_182503
Protein Refseq NP_872309
UniProt ID Q7Z6V5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADAT2 Products

Required fields are marked with *

My Review for All ADAT2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon