Recombinant Human ADGRF1 Protein, GST-tagged
| Cat.No. : | ADGRF1-5170H |
| Product Overview : | Human GPR110 full-length ORF ( NP_079324.2, 1 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ADGRF1 (Adhesion G Protein-Coupled Receptor F1) is a Protein Coding gene. GO annotations related to this gene include G-protein coupled receptor activity and transmembrane signaling receptor activity. An important paralog of this gene is ADGRF5. |
| Molecular Mass : | 51.3 kDa |
| AA Sequence : | MKVGVLWLISFFTFTDGHGGFLGKNDGIKTKKELIVNKKKHLGPVEEYQLLLQVTYRDSKEKRDLRNFLKLLKPPLLWSHGLIRIIRAKATTDCNSLNGVLQCTCEDSYTWFPPSCLDPQNCYLHTAGALPSCECHLNNLSQSVNFCERTKIWGTFKINERFTNDLLNSSSAIYSKYANGIEIQLKKAYERIQGFESVQVTQFRMSLLSPKLECNGTI |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ADGRF1 adhesion G protein-coupled receptor F1 [ Homo sapiens (human) ] |
| Official Symbol | ADGRF1 |
| Synonyms | GPR110; G protein-coupled receptor 110; probable G-protein coupled receptor 110; hGPCR36; PGR19; G-protein coupled receptor 110; G protein-coupled receptor PGR19; G-protein coupled receptor PGR19; G-protein coupled receptor KPG_012; seven transmembrane helix receptor; KPG_012; FLJ22684; FLJ30646; MGC125952; |
| Gene ID | 266977 |
| mRNA Refseq | NM_025048 |
| Protein Refseq | NP_079324 |
| MIM | 617430 |
| UniProt ID | Q5T601 |
| ◆ Recombinant Proteins | ||
| ADGRF1-5567HF | Recombinant Full Length Human ADGRF1 Protein, GST-tagged | +Inquiry |
| ADGRF1-5566HF | Recombinant Full Length Human ADGRF1 Protein | +Inquiry |
| ADGRF1-5170H | Recombinant Human ADGRF1 Protein, GST-tagged | +Inquiry |
| ADGRF1-5169H | Recombinant Human ADGRF1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADGRF1 Products
Required fields are marked with *
My Review for All ADGRF1 Products
Required fields are marked with *
