Recombinant Human ADGRF1 Protein, GST-tagged

• Cat.No.: ADGRF1-5170H
• Product Overview: Human GPR110 full-length ORF ( NP_079324.2, 1 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ADGRF1 (Adhesion G Protein-Coupled Receptor F1) is a Protein Coding gene. GO annotations related to this gene include G-protein coupled receptor activity and transmembrane signaling receptor activity. An important paralog of this gene is ADGRF5.
• Molecular Mass: 51.3 kDa
• AA Sequence: MKVGVLWLISFFTFTDGHGGFLGKNDGIKTKKELIVNKKKHLGPVEEYQLLLQVTYRDSKEKRDLRNFLKLLKPPLLWSHGLIRIIRAKATTDCNSLNGVLQCTCEDSYTWFPPSCLDPQNCYLHTAGALPSCECHLNNLSQSVNFCERTKIWGTFKINERFTNDLLNSSSAIYSKYANGIEIQLKKAYERIQGFESVQVTQFRMSLLSPKLECNGTI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ADGRF1 adhesion G protein-coupled receptor F1 [ Homo sapiens (human) ]
• Official Symbol: ADGRF1
• Synonyms: GPR110; G protein-coupled receptor 110; probable G-protein coupled receptor 110; hGPCR36; PGR19; G-protein coupled receptor 110; G protein-coupled receptor PGR19; G-protein coupled receptor PGR19; G-protein coupled receptor KPG_012; seven transmembrane helix receptor; KPG_012; FLJ22684; FLJ30646; MGC125952
• Gene ID: 266977
• mRNA Refseq: NM_025048
• Protein Refseq: NP_079324
• MIM: 617430
• UniProt ID: Q5T601