"ADGRG5" Related Products

Recombinant Human ADGRG5 protein, T7/His-tagged

Cat.No.: ADGRG5-177H
Product Overview: Recombinant human GPR114 extracellular domain cDNA (22 - 250 aa, derived from BC032401) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEETWEELLSYMENMQVSRGRSSVFSSRQLHQLEQMLLNTSFPGYNLTL QTPTIQSLAFKLSCDFSGLSLTSATLKRVPQAGGQHARGQHAMQFPAELTRDACKTRPRELRLICIYFSNTHFFK DENNSSLLNNYVLGAQLSHGHVNNLRDPVNISFWHNQSLEGYTLTCVFWKEGARKQPWGGWSPEGCRTEQPSHSQ VLCRCNHLTYFAVLMQLSPALVPAELLAPLTY
Purity: >90% by SDS-PAGE.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name: ADGRG5 adhesion G protein-coupled receptor G5 [ Homo sapiens ]
Official Symbol: ADGRG5
Synonyms: PGR27; GPR114; G protein-coupled receptor 114; G protein-coupled receptor PGR27
Gene ID: 221188
mRNA Refseq: NM_001304376
Protein Refseq: NP_001291305
MIM:
UniProt ID: Q8IZF4
Chromosome Location: 16q21
Function: G-protein coupled receptor activity

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.