Recombinant Human ADGRL4 protein, T7/His-tagged
| Cat.No. : | ADGRL4-207H |
| Product Overview : | Recombinant human ELTD1 cDNA (85-432aa, derived from BC025721) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 85-432 a.a. |
| Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFMCVPGFRSSSNQDRFITNDGTVCIENVNANCHLDNVCIAANINKTL TKIRSIKEPVALLQEVYRNSVTDLSPTDIITYIEILAESSSLLGYKNNTISAKDTLSNSTLTEFVKTVNNFVQRD TFVVWDKLSVNHRRTHLTKLMHTVEQATLRISQSFQKTTEFDTNSTDIALKVFFFDSYNMKHIHPHMNMDGDYIN IFPKRKAAYDSNGNVAVAFVYYKSIGPLLSSSDNFLLKPQNYDNSEEEERVISSVISVSMSSNPPTLYELEKITF TLSHRKVTDRYRSLCAFWNYSPDTMNGSWSSEGCELTYSNETHTSCRCNHLTHFAILMSSGPSIGIKDYNILTRI TQ |
| Purity : | >90% by SDS-PAGE. |
| Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Gene Name | ADGRL4 adhesion G protein-coupled receptor L4 [ Homo sapiens ] |
| Official Symbol | ADGRL4 |
| Synonyms | ETL; ELTD1; KPG_003; EGF, latrophilin and seven transmembrane domain-containing protein 1; EGF-TM7-latrophilin-related protein |
| Gene ID | 64123 |
| mRNA Refseq | NM_022159 |
| Protein Refseq | NP_071442 |
| MIM | 616419 |
| UniProt ID | Q9HBW9 |
| Chromosome Location | 1p33-p32 |
| Pathway | GPCRs, Class B Secretin-like, organism-specific biosystem |
| Function | G-protein coupled receptor activity; calcium ion binding; protein dimerization activity |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADGRL4 Products
Required fields are marked with *
My Review for All ADGRL4 Products
Required fields are marked with *



