"ADI1" Related Products

Expand
Expand
Expand

Recombinant Human ADI1 Protein, GST-tagged

Cat.No. : ADI1-357H
Product Overview : Human ADI1 full-length ORF ( NP_060739.1, 1 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal.
Description : This gene encodes an enzyme that belongs to the aci-reductone dioxygenase family of metal-binding enzymes, which are involved in methionine salvage. This enzyme may regulate mRNA processing in the nucleus, and may carry out different functions depending on its localization. Related pseudogenes have been defined on chromosomes 8 and 20. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2015]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 47.9 kDa
AA Sequence : MVLAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEKNYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing: :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : ADI1 acireductone dioxygenase 1 [ Homo sapiens ]
Official Symbol : ADI1
Synonyms : ADI1; acireductone dioxygenase 1; 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase; APL1; ARD; FLJ10913; HMFT1638; membrane type 1 matrix metalloproteinase cytoplasmic tail binding protein 1; MTCBP 1; SIPL; submergence induced protein 2; submergence-induced protein-like factor; MT1-MMP cytoplasmic tail-binding protein-1; acireductone dioxygenase (Fe(2+)-requiring); acireductone dioxygenase (Ni(2+)-requiring); membrane-type 1 matrix metalloproteinase cytoplasmic tail binding protein-1; Fe-ARD; MTCBP1; Ni-ARD;
Gene ID : 55256
mRNA Refseq : NM_018269
Protein Refseq : NP_060739
MIM : 613400
UniProt ID : Q9BV57

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.