Recombinant Human ADIPOR1 Full Length Transmembrane protein, His-SUMO & Myc-tagged
| Cat.No. : | ADIPOR1-249H |
| Product Overview : | Recombinant Human ADIPOR1 protein(Q96A54)(1-375aa), fused with N-terminal His-SUMO tag and C-terminal Myc tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc&SUMO |
| Protein Length : | 1-375aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 62.6kDa |
| AA Sequence : | MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | ADIPOR1 adiponectin receptor 1 [ Homo sapiens ] |
| Official Symbol | ADIPOR1 |
| Synonyms | ADIPOR1; adiponectin receptor 1; adiponectin receptor protein 1; ACDCR1; PAQR1; progestin and adipoQ receptor family member I; CGI45; CGI-45; TESBP1A; FLJ25385; FLJ42464; |
| Gene ID | 51094 |
| mRNA Refseq | NM_015999 |
| Protein Refseq | NP_057083 |
| MIM | 607945 |
| UniProt ID | Q96A54 |
| ◆ Recombinant Proteins | ||
| ADIPOR1-9426H | Recombinant Human ADIPOR1, GST-tagged | +Inquiry |
| ADIPOR1-22H | Recombinant Human ADIPOR1 protein, MYC/DDK-tagged | +Inquiry |
| Adipor1-1541M | Recombinant Mouse Adipor1 Protein, Myc/DDK-tagged | +Inquiry |
| ADIPOR1-285H | Recombinant Human ADIPOR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ADIPOR1-2350H | Recombinant Human ADIPOR1 protein, His-SUMO & Myc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADIPOR1-026HKCL | Human ADIPOR1 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADIPOR1 Products
Required fields are marked with *
My Review for All ADIPOR1 Products
Required fields are marked with *
