Recombinant Human ADIPOR1 protein, His-Flag-tagged
Cat.No. : | ADIPOR1-2351H |
Product Overview : | Recombinant Human ADIPOR1 protein(Q96A54)(89-375aa), fused to N-terminal His-Flag tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | Flag&His |
Protein Length : | 89-375aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 34.8 kDa |
AA Sequence : | EGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ADIPOR1 adiponectin receptor 1 [ Homo sapiens ] |
Official Symbol | ADIPOR1 |
Synonyms | ADIPOR1; adiponectin receptor 1; adiponectin receptor protein 1; ACDCR1; PAQR1; progestin and adipoQ receptor family member I; CGI45; CGI-45; TESBP1A; FLJ25385; FLJ42464; |
Gene ID | 51094 |
mRNA Refseq | NM_015999 |
Protein Refseq | NP_057083 |
MIM | 607945 |
UniProt ID | Q96A54 |
◆ Recombinant Proteins | ||
ADIPOR1-2707C | Recombinant Chicken ADIPOR1 | +Inquiry |
ADIPOR1-691HFL | Recombinant Full Length Human ADIPOR1 Protein, C-Flag-tagged | +Inquiry |
RFL34881MF | Recombinant Full Length Mouse Adiponectin Receptor Protein 1(Adipor1) Protein, His-Tagged | +Inquiry |
ADIPOR1-609H | Recombinant Human ADIPOR1 protein, His & GST-tagged | +Inquiry |
ADIPOR1-12HF | Recombinant Full Length Human ADIPOR1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADIPOR1 Products
Required fields are marked with *
My Review for All ADIPOR1 Products
Required fields are marked with *