Recombinant Human ADORA1 Full Length Transmembrane protein, His-tagged
| Cat.No. : | ADORA1-1052H |
| Product Overview : | Recombinant Human ADORA1 protein(P30542)(1-326aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-326aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 39.3 kDa |
| AA Sequence : | MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | ADORA1 adenosine A1 receptor [ Homo sapiens ] |
| Official Symbol | ADORA1 |
| Synonyms | ADORA1; adenosine A1 receptor; adenosine receptor A1; RDC7; |
| Gene ID | 134 |
| mRNA Refseq | NM_000674 |
| Protein Refseq | NP_000665 |
| MIM | 102775 |
| UniProt ID | P30542 |
| ◆ Recombinant Proteins | ||
| ADORA1-82R | Recombinant Rhesus Macaque ADORA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ADORA1-1150HFL | Recombinant Human ADORA1 protein, His&Flag-tagged | +Inquiry |
| RFL-3226GF | Recombinant Full Length Chicken Adenosine Receptor A1(Adora1) Protein, His-Tagged | +Inquiry |
| ADORA1-1370M | Recombinant Mouse ADORA1 Protein | +Inquiry |
| ADORA1-5889C | Recombinant Chicken ADORA1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADORA1-9006HCL | Recombinant Human ADORA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADORA1 Products
Required fields are marked with *
My Review for All ADORA1 Products
Required fields are marked with *
