Recombinant Human ADORA1 Full Length Transmembrane protein, His-tagged
Cat.No. : | ADORA1-1052H |
Product Overview : | Recombinant Human ADORA1 protein(P30542)(1-326aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-326aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 39.3 kDa |
AA Sequence : | MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | ADORA1 adenosine A1 receptor [ Homo sapiens ] |
Official Symbol | ADORA1 |
Synonyms | ADORA1; adenosine A1 receptor; adenosine receptor A1; RDC7; |
Gene ID | 134 |
mRNA Refseq | NM_000674 |
Protein Refseq | NP_000665 |
MIM | 102775 |
UniProt ID | P30542 |
◆ Recombinant Proteins | ||
ADORA1-6958Z | Recombinant Zebrafish ADORA1 | +Inquiry |
ADORA1-532R | Recombinant Rat ADORA1 Protein | +Inquiry |
RFL-8763CF | Recombinant Full Length Dog Adenosine Receptor A1(Adora1) Protein, His-Tagged | +Inquiry |
RFL25509MF | Recombinant Full Length Mouse Adenosine Receptor A1(Adora1) Protein, His-Tagged | +Inquiry |
Adora1-3159C | Recombinant Cavia porcellus (Guinea pig) Adora1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADORA1-9006HCL | Recombinant Human ADORA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADORA1 Products
Required fields are marked with *
My Review for All ADORA1 Products
Required fields are marked with *
0
Inquiry Basket