Recombinant Human ADORA2B Protein

Cat.No. : ADORA2B-370H
Product Overview : Human ADORA2B full-length ORF (ABM82640.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : This gene encodes an adenosine receptor that is a member of the G protein-coupled receptor superfamily. This integral membrane protein stimulates adenylate cyclase activity in the presence of adenosine. This protein also interacts with netrin-1, which is involved in axon elongation. The gene is located near the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq, Jul 2008]
Form : Liquid
Molecular Mass : 36.52 kDa
AA Sequence : MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFAIPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGTRARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMSYMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIVGIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYTFHKIISRYLLCQADVKSGNGQAGVQPALGVGL
Applications : Antibody Production
Functional Study
Compound Screening
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH 8.0 containing 2% glycerol.
Gene Name ADORA2B adenosine A2b receptor [ Homo sapiens ]
Official Symbol ADORA2B
Synonyms ADORA2B; adenosine A2b receptor; adenosine receptor A2b; ADORA2;
Gene ID 136
mRNA Refseq NM_000676
Protein Refseq NP_000667
MIM 600446
UniProt ID P29275

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADORA2B Products

Required fields are marked with *

My Review for All ADORA2B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon