Recombinant Human ADORA2B Protein
Cat.No. : | ADORA2B-370H |
Product Overview : | Human ADORA2B full-length ORF (ABM82640.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | This gene encodes an adenosine receptor that is a member of the G protein-coupled receptor superfamily. This integral membrane protein stimulates adenylate cyclase activity in the presence of adenosine. This protein also interacts with netrin-1, which is involved in axon elongation. The gene is located near the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq, Jul 2008] |
Form : | Liquid |
Molecular Mass : | 36.52 kDa |
AA Sequence : | MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFAIPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGTRARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMSYMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIVGIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYTFHKIISRYLLCQADVKSGNGQAGVQPALGVGL |
Applications : | Antibody Production Functional Study Compound Screening |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH 8.0 containing 2% glycerol. |
Gene Name | ADORA2B adenosine A2b receptor [ Homo sapiens ] |
Official Symbol | ADORA2B |
Synonyms | ADORA2B; adenosine A2b receptor; adenosine receptor A2b; ADORA2; |
Gene ID | 136 |
mRNA Refseq | NM_000676 |
Protein Refseq | NP_000667 |
MIM | 600446 |
UniProt ID | P29275 |
◆ Recombinant Proteins | ||
RFL-14450RF | Recombinant Full Length Rat Adenosine Receptor A2B(Adora2B) Protein, His-Tagged | +Inquiry |
RFL-32929HF | Recombinant Full Length Human Adenosine Receptor A2B(Adora2B) Protein, His-Tagged | +Inquiry |
ADORA2B-300H | Recombinant Human ADORA2B protein, His-SUMO-tagged | +Inquiry |
ADORA2B-972HF | Recombinant Full Length Human ADORA2B Protein | +Inquiry |
ADORA2B-370H | Recombinant Human ADORA2B Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADORA2B-9005HCL | Recombinant Human ADORA2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADORA2B Products
Required fields are marked with *
My Review for All ADORA2B Products
Required fields are marked with *
0
Inquiry Basket