Recombinant Human ADORA2B Protein
| Cat.No. : | ADORA2B-370H |
| Product Overview : | Human ADORA2B full-length ORF (ABM82640.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Description : | This gene encodes an adenosine receptor that is a member of the G protein-coupled receptor superfamily. This integral membrane protein stimulates adenylate cyclase activity in the presence of adenosine. This protein also interacts with netrin-1, which is involved in axon elongation. The gene is located near the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq, Jul 2008] |
| Form : | Liquid |
| Molecular Mass : | 36.52 kDa |
| AA Sequence : | MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFAIPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGTRARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMSYMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIVGIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYTFHKIISRYLLCQADVKSGNGQAGVQPALGVGL |
| Applications : | Antibody Production Functional Study Compound Screening |
| Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH 8.0 containing 2% glycerol. |
| Gene Name | ADORA2B adenosine A2b receptor [ Homo sapiens ] |
| Official Symbol | ADORA2B |
| Synonyms | ADORA2B; adenosine A2b receptor; adenosine receptor A2b; ADORA2; |
| Gene ID | 136 |
| mRNA Refseq | NM_000676 |
| Protein Refseq | NP_000667 |
| MIM | 600446 |
| UniProt ID | P29275 |
| ◆ Recombinant Proteins | ||
| RFL-8285GF | Recombinant Full Length Chicken Adenosine Receptor A2B(Adora2B) Protein, His-Tagged | +Inquiry |
| RFL-32929HF | Recombinant Full Length Human Adenosine Receptor A2B(Adora2B) Protein, His-Tagged | +Inquiry |
| ADORA2B-3164C | Recombinant Chicken ADORA2B, His-tagged | +Inquiry |
| ADORA2B-1372M | Recombinant Mouse ADORA2B Protein | +Inquiry |
| ADORA2B-6644C | Recombinant Chicken ADORA2B | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADORA2B-9005HCL | Recombinant Human ADORA2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADORA2B Products
Required fields are marked with *
My Review for All ADORA2B Products
Required fields are marked with *
