Recombinant Human ADORA2B protein, His-tagged
Cat.No. : | ADORA2B-6744H |
Product Overview : | Recombinant Human ADORA2B protein(189-332 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 189-332 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | GCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIVGIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYTFHKIISRYLLCQADVKSGNGQAGVQPALGVGL |
Gene Name | ADORA2B adenosine A2b receptor [ Homo sapiens ] |
Official Symbol | ADORA2B |
Synonyms | ADORA2B; adenosine A2b receptor; adenosine receptor A2b; ADORA2; |
Gene ID | 136 |
mRNA Refseq | NM_000676 |
Protein Refseq | NP_000667 |
MIM | 600446 |
UniProt ID | P29275 |
◆ Recombinant Proteins | ||
ADORA2B-534R | Recombinant Rat ADORA2B Protein | +Inquiry |
RFL-14450RF | Recombinant Full Length Rat Adenosine Receptor A2B(Adora2B) Protein, His-Tagged | +Inquiry |
RFL26241MF | Recombinant Full Length Mouse Adenosine Receptor A2B(Adora2B) Protein, His-Tagged | +Inquiry |
ADORA2B-190R | Recombinant Rat ADORA2B Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL24773OF | Recombinant Full Length Rabbit Adenosine Receptor A2B(Adora2B) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADORA2B-9005HCL | Recombinant Human ADORA2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADORA2B Products
Required fields are marked with *
My Review for All ADORA2B Products
Required fields are marked with *