Recombinant Human ADPGK protein, His-tagged
Cat.No. : | ADPGK-5433H |
Product Overview : | Recombinant Human ADPGK protein(148-497 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 148-497 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | EFPGAQHYVGGNAALIGQKFAANSDLKVLLCGPVGPKLHELLDDNVFVPPESLQEVDEFHLILEYQAGEEWGQLKAPHANRFIFSHDLSNGAMNMLEVFVSSLEEFQPDLVVLSGLHMMEGQSKELQRKRLLEVVTSISDIPTGIPVHLELASMTNRELMSSIVHQQVFPAVTSLGLNEQELLFLTQSASGPHSSLSSWNGVPDVGMVSDILFWILKEHGRSKSRASDLTRIHFHTLVYHILATVDGHWANQLAAVAAGARVAGTQACATETIDTSRVSLRAPQEFMTSHSEAGSRIVLNPNKPVVEWHREGISFHFTPVLVCKDPIRTVGLGDAISAEGLFYSEVHPHY |
Gene Name | ADPGK ADP-dependent glucokinase [ Homo sapiens ] |
Official Symbol | ADPGK |
Synonyms | ADPGK; ADP-dependent glucokinase; ADP GK; DKFZp434B195; rbBP-35; ATP-dependent glucokinase; ADP-GK; 2610017G09Rik; |
Gene ID | 83440 |
mRNA Refseq | NM_031284 |
Protein Refseq | NP_112574 |
MIM | 611861 |
UniProt ID | Q9BRR6 |
◆ Recombinant Proteins | ||
ADPGK-33H | Recombinant Human ADPGK protein, GST-tagged | +Inquiry |
ADPGK-3204B | Recombinant Bovine ADPGK, His-tagged | +Inquiry |
ADPGK-4923Z | Recombinant Zebrafish ADPGK | +Inquiry |
ADPGK-985H | Recombinant Human ADPGK protein, MYC/DDK-tagged | +Inquiry |
ADPGK-1374M | Recombinant Mouse ADPGK Protein | +Inquiry |
◆ Native Proteins | ||
ADPGK-45 | Active Native ADP-specific glucokinase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADPGK-9004HCL | Recombinant Human ADPGK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADPGK Products
Required fields are marked with *
My Review for All ADPGK Products
Required fields are marked with *