Recombinant Human ADPRH Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | ADPRH-2357H |
| Product Overview : | ADPRH MS Standard C13 and N15-labeled recombinant protein (NP_001116) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The enzyme encoded by this gene catalyzes removal of mono-ADP-ribose from arginine residues of proteins in the ADP-ribosylation cycle. Unlike the rat and mouse enzymes that require DTT for maximal activity, the human enzyme is DTT-independent. Alternatively spliced transcript variants that encode different protein isoforms have been described. |
| Molecular Mass : | 39.5 kDa |
| AA Sequence : | MEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALVEAGKAPKLTQLYYLLAKHYQDCMEDMDGRAPGGASVHNAMQLKPGKPNGWRIPFNSHEGGCGAAMRAMCIGLRFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALASALFTAYAVNSRPPLQWGKGLMELLPEAKKYIVQSGYFVEENLQHWSYFQTKWENYLKLRGILDGESAPTFPESFGVKERDQFYTSLSYSGWGGSSGHDAPMIAYDAVLAAGDSWKELAHRAFFHGGDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTVISLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | ADPRH ADP-ribosylarginine hydrolase [ Homo sapiens (human) ] |
| Official Symbol | ADPRH |
| Synonyms | ADPRH; ADP-ribosylarginine hydrolase; ARH1; hARH1; ADP-ribosylarginine hydrolase; ADP-ribose-L-arginine cleaving enzyme; [Protein ADP-ribosylarginine] hydrolase; EC 3.2.2.19 |
| Gene ID | 141 |
| mRNA Refseq | NM_001125 |
| Protein Refseq | NP_001116 |
| MIM | 603081 |
| UniProt ID | P54922 |
| ◆ Recombinant Proteins | ||
| ADPRH-359M | Recombinant Mouse ADPRH Protein, His (Fc)-Avi-tagged | +Inquiry |
| ADPRH-2063H | Recombinant Human ADP-ribosylarginine Hydrolase, His-tagged | +Inquiry |
| Adprh-547M | Recombinant Mouse Adprh Protein, MYC/DDK-tagged | +Inquiry |
| ADPRH-2518H | Recombinant Human ADP-Ribosylarginine Hydrolase, His-tagged | +Inquiry |
| ADPRH-2543H | Recombinant Human ADPRH protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADPRH-9003HCL | Recombinant Human ADPRH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADPRH Products
Required fields are marked with *
My Review for All ADPRH Products
Required fields are marked with *
