Recombinant Human AFM protein, His-tagged
Cat.No. : | AFM-3264H |
Product Overview : | Recombinant Human AFM protein(264-599 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 264-599 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | SNYDGCCEGDVVQCIRDTSKVMNHICSKQDSISSKIKECCEKKIPERGQCIINSNKDDRPKDLSLREGKFTDSENVCQERDADPDTFFAKFTFEYSRRHPDLSIPELLRIVQIYKDLLRNCCNTENPPGCYRYAEDKFNETTEKSLKMVQQECKHFQNLGKDGLKYHYLIRLTKIAPQLSTEELVSLGEKMVTAFTTCCTLSEEFACVDNLADLVFGELCGVNENRTINPAVDHCCKTNFAFRRPCFESLKADKTYVPPPFSQDLFTFHADMCQSQNEELQRKTDRFLVNLVKLKHELTDEELQSLFTNFANVVDKCCKAESPEVCFNEESPKIGN |
Gene Name | AFM afamin [ Homo sapiens ] |
Official Symbol | AFM |
Synonyms | AFM; afamin; ALB2; ALBA; alpha-Alb; alpha-albumin; ALF; MGC125338; MGC125339; |
Gene ID | 173 |
mRNA Refseq | NM_001133 |
Protein Refseq | NP_001124 |
MIM | 104145 |
UniProt ID | P43652 |
◆ Recombinant Proteins | ||
AFM-26448TH | Recombinant Human AFM | +Inquiry |
AFM-210R | Recombinant Rat AFM Protein, His (Fc)-Avi-tagged | +Inquiry |
AFM-554R | Recombinant Rat AFM Protein | +Inquiry |
AFM-1087H | Recombinant Human AFM protein(Met1-Asn599), His-tagged | +Inquiry |
Afm-499M | Recombinant Mouse Afm Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AFM-794HCL | Recombinant Human AFM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AFM Products
Required fields are marked with *
My Review for All AFM Products
Required fields are marked with *
0
Inquiry Basket