Recombinant Human AFP protein, His-tagged
| Cat.No. : | AFP-9461H |
| Product Overview : | Recombinant Human AFP protein(260-609 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | November 19, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 260-609 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | LDVAHVHEHCCRGDVLDCLQDGEKIMSYICSQQDTLSNKITECCKLTTLERGQCIIHAENDEKPEGLSPNLNRFLGDRDFNQFSSGEKNIFLASFVHEYSRRHPQLAVSVILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLLACGEGAADIIIGHLCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV |
| Gene Name | AFP alpha-fetoprotein [ Homo sapiens ] |
| Official Symbol | AFP |
| Synonyms | AFP; alpha-fetoprotein; HPAFP; FETA; alpha-fetoglobulin; alpha-1-fetoprotein; |
| Gene ID | 174 |
| mRNA Refseq | NM_001134 |
| Protein Refseq | NP_001125 |
| UniProt ID | P02771 |
| ◆ Recombinant Proteins | ||
| afp-3937A | Recombinant Aspergillus giganteus afp protein, His-B2M-tagged | +Inquiry |
| AFP-125P | Recombinant Pig AFP Protein, His/GST-tagged | +Inquiry |
| AFP-4769H | Human Alpha-Fetoprotein | +Inquiry |
| AFP-1404M | Recombinant Mouse AFP Protein | +Inquiry |
| AFP-1711C | Recombinant Canine AFP protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| AFP-3018P | Native pig AFP | +Inquiry |
| AFP-412H | Native Human AFP Protein | +Inquiry |
| AFP-3017H | Native Human fetal cord serum | +Inquiry |
| AFP-1180H | Native Human Alpha-Fetoprotein | +Inquiry |
| AFP-8027H | Native Human Alpha FetoProtein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AFP-1706HCL | Recombinant Human AFP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AFP Products
Required fields are marked with *
My Review for All AFP Products
Required fields are marked with *
