Recombinant Human AFP protein, His-tagged
Cat.No. : | AFP-9461H |
Product Overview : | Recombinant Human AFP protein(260-609 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | June 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 260-609 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | LDVAHVHEHCCRGDVLDCLQDGEKIMSYICSQQDTLSNKITECCKLTTLERGQCIIHAENDEKPEGLSPNLNRFLGDRDFNQFSSGEKNIFLASFVHEYSRRHPQLAVSVILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLLACGEGAADIIIGHLCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV |
Gene Name | AFP alpha-fetoprotein [ Homo sapiens ] |
Official Symbol | AFP |
Synonyms | AFP; alpha-fetoprotein; HPAFP; FETA; alpha-fetoglobulin; alpha-1-fetoprotein; |
Gene ID | 174 |
mRNA Refseq | NM_001134 |
Protein Refseq | NP_001125 |
UniProt ID | P02771 |
◆ Recombinant Proteins | ||
AFP-4180H | Purified Human Alpha-Fetoprotein | +Inquiry |
AFP-120H | Recombinant Human AFP Protein, His-tagged | +Inquiry |
AFP-1447C | Recombinant Cynomolgus AFP protein, His-tagged | +Inquiry |
AFP-52H | Recombinant Human AFP Protein, His-tagged | +Inquiry |
AFP-9461H | Recombinant Human AFP protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
AFP-412H | Native Human AFP Protein | +Inquiry |
AFP-1180H | Native Human Alpha-Fetoprotein | +Inquiry |
AFP-3017H | Native Human fetal cord serum | +Inquiry |
AFP-3018P | Native pig AFP | +Inquiry |
AFP-8027H | Native Human Alpha FetoProtein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AFP-1706HCL | Recombinant Human AFP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AFP Products
Required fields are marked with *
My Review for All AFP Products
Required fields are marked with *