Recombinant Human AGAP3 protein, GST-tagged
| Cat.No. : | AGAP3-301203H |
| Product Overview : | Recombinant Human AGAP3 (474-556 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Leu474-Thr556 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | LAIGPCKSLPNSPSHSAVSAASIPAVHINQATNGGGSAFSDYSSSVPSTPSISQRELRIETIAASSTPTPIRKQSKRRSNIFT |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | AGAP3 ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 [ Homo sapiens ] |
| Official Symbol | AGAP3 |
| Synonyms | AGAP3; ArfGAP with GTPase domain, ankyrin repeat and PH domain 3; centaurin, gamma 3 , CENTG3; arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3; centaurin-gamma-3; centaurin, gamma 3; CRAM-associated GTPase; MR1-interacting protein; CRMP (collapsin response mediator protein) associated; CRAG; AGAP-3; CENTG3; MRIP-1; cnt-g3; FLJ16146; FLJ34452; |
| Gene ID | 116988 |
| mRNA Refseq | NM_001042535 |
| Protein Refseq | NP_001036000 |
| UniProt ID | Q96P47 |
| ◆ Recombinant Proteins | ||
| AGAP3-0009H | Recombinant Human AGAP3 Protein, GST-Tagged | +Inquiry |
| AGAP3-2745H | Recombinant Human AGAP3 protein, GST-tagged | +Inquiry |
| AGAP3-301203H | Recombinant Human AGAP3 protein, GST-tagged | +Inquiry |
| AGAP3-541H | Recombinant Human AGAP3 Protein, MYC/DDK-tagged | +Inquiry |
| Agap3-1551M | Recombinant Mouse Agap3 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGAP3 Products
Required fields are marked with *
My Review for All AGAP3 Products
Required fields are marked with *
