Recombinant Human AGAP3 protein, GST-tagged
Cat.No. : | AGAP3-301203H |
Product Overview : | Recombinant Human AGAP3 (474-556 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Leu474-Thr556 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | LAIGPCKSLPNSPSHSAVSAASIPAVHINQATNGGGSAFSDYSSSVPSTPSISQRELRIETIAASSTPTPIRKQSKRRSNIFT |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | AGAP3 ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 [ Homo sapiens ] |
Official Symbol | AGAP3 |
Synonyms | AGAP3; ArfGAP with GTPase domain, ankyrin repeat and PH domain 3; centaurin, gamma 3 , CENTG3; arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3; centaurin-gamma-3; centaurin, gamma 3; CRAM-associated GTPase; MR1-interacting protein; CRMP (collapsin response mediator protein) associated; CRAG; AGAP-3; CENTG3; MRIP-1; cnt-g3; FLJ16146; FLJ34452; |
Gene ID | 116988 |
mRNA Refseq | NM_001042535 |
Protein Refseq | NP_001036000 |
UniProt ID | Q96P47 |
◆ Recombinant Proteins | ||
ABHD1-4633H | Recombinant Human ABHD1 protein, His-tagged | +Inquiry |
AGAP3-541H | Recombinant Human AGAP3 Protein, MYC/DDK-tagged | +Inquiry |
ABCG8-2433H | Recombinant Human ABCG8 protein, His-tagged | +Inquiry |
AGAP3-301203H | Recombinant Human AGAP3 protein, GST-tagged | +Inquiry |
Agap3-1551M | Recombinant Mouse Agap3 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AGAP3 Products
Required fields are marked with *
My Review for All AGAP3 Products
Required fields are marked with *
0
Inquiry Basket