Recombinant Human AGBL4 Protein, GST-tagged
Cat.No. : | AGBL4-418H |
Product Overview : | Human AGBL4 full-length ORF ( ADR83127.1, 1 a.a. - 268 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | AGBL4 (ATP/GTP Binding Protein Like 4) is a Protein Coding gene. Diseases associated with AGBL4 include Macular Degeneration, Age-Related, 1. GO annotations related to this gene include tubulin binding and metallocarboxypeptidase activity. An important paralog of this gene is AGBL5. |
Molecular Mass : | 29.5 kDa |
AA Sequence : | MDYFFREQLGQSVQQRKLDLLTITSPDNLREGAEQKVVFITGRVHPGETPSSFVCQGIIDFLVSQHPIACVLREYLVFKIAPMLNPDGVYLGNYRCSLMGFDLNRHWLDPSPWVHPTLHGVKQLIVQMYNDPKTSLEFYIDIHAHSTMMNGFMYGNIFEDEERFQRQAIFPKLLCQNAEDFSYSSTSFNRDAVKAGTGRRFLGGLLDHTSYCYTLEVSFYSYIISGTTAAVPYTEEACILSPHPALGQPSSSREYPSLTGQELGPQLR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AGBL4 ATP/GTP binding protein-like 4 [ Homo sapiens ] |
Official Symbol | AGBL4 |
Synonyms | AGBL4; ATP/GTP binding protein-like 4; cytosolic carboxypeptidase 6; FLJ14442; ATP/GTP-binding protein-like 4; CCP6; |
Gene ID | 84871 |
mRNA Refseq | NM_032785 |
Protein Refseq | NP_116174 |
MIM | 616476 |
UniProt ID | Q5VU57 |
◆ Recombinant Proteins | ||
AGBL4-2509H | Recombinant Human AGBL4 protein, His-tagged | +Inquiry |
AGBL4-996HF | Recombinant Full Length Human AGBL4 Protein, GST-tagged | +Inquiry |
AGBL4-1412M | Recombinant Mouse AGBL4 Protein | +Inquiry |
AGBL4-384M | Recombinant Mouse AGBL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
AGBL4-418H | Recombinant Human AGBL4 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AGBL4 Products
Required fields are marked with *
My Review for All AGBL4 Products
Required fields are marked with *
0
Inquiry Basket