Recombinant Human AGPAT3 Protein, GST-tagged

Cat.No. : AGPAT3-430H
Product Overview : Human AGPAT3 full-length ORF ( AAH04219.1, 1 a.a. - 63 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is an acyltransferase that converts lysophosphatidic acid into phosphatidic acid, which is the second step in the de novo phospholipid biosynthetic pathway. The encoded protein may be an integral membrane protein. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Molecular Mass : 33.7 kDa
AA Sequence : MGSPAHLPKDAIAVFIVFPRVRHWLSGTRRQCTRRAPYVRCFKVPVLRKRSLVEEMSAEQITK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AGPAT3 1-acylglycerol-3-phosphate O-acyltransferase 3 [ Homo sapiens ]
Official Symbol AGPAT3
Synonyms AGPAT3; 1-acylglycerol-3-phosphate O-acyltransferase 3; 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma; LPAAT gamma; 1-AGPAT 3; 1-AGP acyltransferase 3; lysophosphatidic acid acyltransferase gamma; lysophosphatidic acid acyltransferase-gamma1; LPAAT-GAMMA1; MGC4604;
Gene ID 56894
mRNA Refseq NM_001037553
Protein Refseq NP_001032642
MIM 614796
UniProt ID Q9NRZ7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AGPAT3 Products

Required fields are marked with *

My Review for All AGPAT3 Products

Required fields are marked with *

0
cart-icon
0
compare icon