Recombinant Human AGPAT3 protein, His-tagged
| Cat.No. : | AGPAT3-3665H |
| Product Overview : | Recombinant Human AGPAT3 protein(326-376 aa), fused to His tag, was expressed in E. coli. |
| Availability | July 08, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 326-376 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | VLGVFASGSPLLILTFLGFVGAASFGVRRLIGVTEIEKGSSYGNQEFKKKE |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | AGPAT3 1-acylglycerol-3-phosphate O-acyltransferase 3 [ Homo sapiens ] |
| Official Symbol | AGPAT3 |
| Synonyms | AGPAT3; 1-acylglycerol-3-phosphate O-acyltransferase 3; 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma; LPAAT gamma; 1-AGPAT 3; 1-AGP acyltransferase 3; lysophosphatidic acid acyltransferase gamma; lysophosphatidic acid acyltransferase-gamma1; LPAAT-GAMMA1; MGC4604; |
| Gene ID | 56894 |
| mRNA Refseq | NM_001037553 |
| Protein Refseq | NP_001032642 |
| UniProt ID | Q9NRZ7 |
| ◆ Cell & Tissue Lysates | ||
| AGPAT3-8976HCL | Recombinant Human AGPAT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGPAT3 Products
Required fields are marked with *
My Review for All AGPAT3 Products
Required fields are marked with *
